login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EGEST952
Organism Anopheles gambiae str. PEST
Gene Name agEGEST952
Product NADH-ubiquinone oxidoreductase MNLL subunit (NINM) (By similarity)
GENE MAP
Chromosome X
Citogenetic Map 5A
Gene Map  --
Comment This record is derived from the following: gb|AAAB01008963.1 gb|BM636278.1 5', mRNA sequence The following contributed to reference sequence development: bases 1..2340 - gb|AAAB01008963.1 674523..672184
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGESTG00000000952
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008963.1
Sequence Location 674523..672184
Sequence Lenght 2340bp
Relative Gene location 751 .. 1348
CDS
CDS Location 1101 .. 1268
Sequence Lenght 55aa
Translation MFGLNRQYLWSVVPLFGFGVGWFLDRKETERMTMFRDKSALYGRTLKEGEKPSWP
mRNA
mRNA Location 751 .. 1348
5'UTR Location 751..1100
3'UTR Location 1269..1348
Exon 751..1348
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GTAAGGCAAAACTTTTTTCCCCCCATCCGAAATTTGCTAACTATTAATTGTGAAATTCCA
ACCGGCATCCTCGTACACGGGTCTCATCATTGTTTTCTCCCATTTGGCAACGACGACGTG
AACACCCGCCAGCCAGCCAATGATTCGCCAGTTCTGGAACCGCTACAAGGTCGTGATCAT
CTTCCCAGCGCTCGCGTTCGGCTCGATTGCGGCAGACTACAGCTACACCCGGCAGTGGAA
AAAGACTCGCCTGGAGCAGATTCAGCAGCAGCAGCAGCAGGCCCAACAACAACAGCTCGC
CTAAAGCAGCACTCAATCTCAACCAACCAACGCACACGCCAATCAACGCG
ATGTTCGGGC
TGAACCGTCAGTATCTGTGGAGTGTGGTGCCGCTGTTCGGGTTCGGCGTCGGCTGGTTCC
TCGACCGGAAGGAAACGGAACGCATGACCATGTTCCGCGACAAGAGTGCCCTGTACGGCC
GCACGCTGAAGGAGGGCGAGAAGCCATCGTGGCCTTAG
GCGGGCAGCCGGAGAGCGAAAG
AGAGCGATTGAAGTACCCCCCTTCTAGAGAGCGAAATACATTGATGTTGTGAACTCGG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GTTTCCAATCCAGATTACTGGTCGTATAACCATTTTATACCAAAAACCACCGAATTTTCA
CAAAATAATGCCGCACGATATGTGCTTTCATTGTTCGACAAATATTAAAGCAAATCAATC
TAAAACGAATTAGACGCCATCATCATCCAATAGAAGCTCGTCTTTAGCATGCACCAACGA
AACTTTGACAATTTCTACACGGAAAATCACACACAAATCTACAATTTTTGGTATCTCGAG
TACCATTCGAGCAGATCAAAATTTAGAACAAGTATCACTTGGGTATTTTGCTCATCGGGT
TTTGCCTATCGGATGACTGCTCAGCTGTTCATACAATTATGCAATTTTCTTTTATTAAAG
TTGTTTTCAAATAACATTCTTGCATTTTATGAACAGTTTTATAATATGTTTACATGGAAA
CTTAAATTGTTAATAGCAAATAGCAATTTCAATTTCAGCAAGCCTTTTTCTGCGATTTGA
GGTAGCTCCGTATTGGAAGATCCATGAAGCTACTACATCAACACATAAACTATATGTAAA
AGGTACCATAATCGTAATAAATACTACTTCAATAAAAATGAACATTTTAAATGTATTGAA
AGAATCTTGAAACATTTTTATCAACAGATAATTAAAGAAAATCGTACTATTTTACGCCAA
ATCCATCTGTCAAAGCGTACAATAACAACAGCCCGAAACGTCAGTGCGCATTTTTGACAC
TTACATAATTCGGTGCAACTTTGGAAAGCGGTAAGGCAAAACTTTTTTCCCCCCATCCGA
AATTTGCTAACTATTAATTGTGAAATTCCAACCGGCATCCTCGTACACGGGTCTCATCAT
TGTTTTCTCCCATTTGGCAACGACGACGTGAACACCCGCCAGCCAGCCAATGATTCGCCA
GTTCTGGAACCGCTACAAGGTCGTGATCATCTTCCCAGCGCTCGCGTTCGGCTCGATTGC
GGCAGACTACAGCTACACCCGGCAGTGGAAAAAGACTCGCCTGGAGCAGATTCAGCAGCA
GCAGCAGCAGGCCCAACAACAACAGCTCGCCTAAAGCAGCACTCAATCTCAACCAACCAA
CGCACACGCCAATCAACGCG
ATGTTCGGGCTGAACCGTCAGTATCTGTGGAGTGTGGTGC
CGCTGTTCGGGTTCGGCGTCGGCTGGTTCCTCGACCGGAAGGAAACGGAACGCATGACCA
TGTTCCGCGACAAGAGTGCCCTGTACGGCCGCACGCTGAAGGAGGGCGAGAAGCCATCGT
GGCCTTAG
GCGGGCAGCCGGAGAGCGAAAGAGAGCGATTGAAGTACCCCCCTTCTAGAGA
GCGAAATACATTGATGTTGTGAACTCGG
ACTGCCTGGCTTATTTGTTGTGTCTTACTATT
ATTTGGGTATCGTTTTAGGACGTGGTCCCAACATCCGGACCAAGGTGTGAGTGGTGAGGG
AAAGGAACTGTATAGGAAGCTTTAATGAATGTTGTTCTAGAGGGACGAGAAATCGTAGGT
TAGGAAAATGTAAGCGGAGTTGCTGCCACAGTGTCGTTTTGTTAAATGTGAACCATCTTA
AGGCGGAAGATATCATTGGAAGGCATTTCGGCCTGCATTCAGGTTGTACGTCAGTTCGCT
TCAAGATTGATAGTTTTTTTTTTGCAATCTTGTGTTTTTGTCTGGAATGGACAATGACCT
AATGCGTATTGCGATGCATCCTTCCAAGAAAGTCACTAGTAAAAGTGTTGTACAACAGTT
GGTGAGCTTTAAAGCAACACCCACTGCTCTAGTACGCATGAGCCACCTTGTCCATGTTCT
TGTTTAATTTTTCGTTTGGATATTGTATTGGAATGCGCTACAGCAGCAGTAGCAGCAGCA
CGAGAGCACGTAAATGAGAACTGCACACACGCGCGCGCTCTGGCGAAGGTCCTTGTGGAC
ATCGCACTTCTTTGCGAGAGGCGATTTTTGAGCCAGAACCAGAGAGTTTGAGAGCGAGAG
AGATCATTTTAAAGGATAAACATGTCAAAGCATCCTTCGATGTGTGTCCTTGCACACACT
TGGGCAATGAACAGCACTGGAATGAGCTTAAGGAAGCACGGGGCAAAGGGCGCCTCCATT
GCGTCACGATCTAAAATCAACTTCAAAGCTTTTTGTGTTGGGTTTCATAAATCTTTCGTT
GAGATTCATTCATATGATTCTTCAGTGATGTGTGATTCGAATCTCGAGTCGAATCTTCAA
AGATTTGTGGTGTTCGGCACCACTGGTGGTGTTGCGCTCCTGGCTGCGTTTCCGAATTCA
CCACTTTCGAGCGTCACACTGTGGTAAGATTAAGTTAGTGTAGGTAGGTAGCGATGTAAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004