login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG12063
Organism Anopheles gambiae str. PEST
Gene Name agEG12063
Product NADH-ubiquinone oxidoreductase MLRQ subunit (NUML) (By similarity)
GENE MAP
Chromosome 2R
Celera Gene agCG47309
Citogenetic Map 15A
Gene Map
Comment This record is derived from the following: gb|AAAB01008904.1 gb|BM590606.1 5', mRNA sequence gb|BM633493.1 5', mRNA sequence  The following contributed to reference sequence development: bases 1..3240 - AAAB01008904.1 600534..603773
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000012063
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008904.1
Sequence Location 600534..603773
Sequence Lenght 3240bp
Relative Gene location 1001 .. 2272
CDS
CDS Location 1150 .. 1831
Sequence Lenght 83aa
Translation MQGLTMASLKKNPALIPLYVCIAMGSAGAVFYTLRLALKSPEVTWSRKNNPEPWEEYRTK
QHKFYSPVRDYSNISSPAPKYTD
mRNA
mRNA Location 1001 .. 2272
5'UTR Location 1001..1149
3'UTR Location 1832..2272
Exon 1001..1191,1405..1551,1769..2272
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
AACCGCATTACGGACCGACTGACGTACGGAATCTTTCTGCTCGCAATCGCAATTGTCCAT
TTTTGCTCCGCCAGTGAAGTGTCGGACTATTTTTCACTCCTAAAGTTGTACTTTTCTGCA
AGCGCAAGAAAACCCATATCCTCGGCAAG
ATGCAGGGACTAACGATGGCTAGTTTGAAGA
AAAACCCAGCG
CTGATCCCGCTGTACGTGTGTATCGCGATGGGTTCGGCTGGAGCCGTCT
TCTACACCCTTCGTCTGGCGCTGAAGAGCCCCGAAGTTACCTGGAGCCGCAAGAACAACC
CCGAGCCGTGGGAGGAATACCGGACCAAGCAGCATAAG
TTCTACTCTCCGGTCAGGGATT
ACTCCAACATTAGCAGCCCGGCCCCGAAGTACACCGACTAA
AGTGTCAGCATATTGTCAG
CCACCGAAGAGGCGCCACCGGCTATAGAATGGGGACGGGGAATCACCACTCTAATATATA
CCCTAGCATCAATAAAACTGGCCGCGGAACGACAACACCGGACGCCCATTCTCCCTCCCC
TATAGTAGTGCAGATGTATTATTTGTCATTTGAGCAGCCGCTGGAAAAGACTCAAAGGAT
AAACGGAATTCGATCGACTAATTGGAACACATTTAGCACGCAGTGATGAAGCGCATACTT
TGGATAAACAACATCCCATCCCAAAACAACAAGACACGGGACGATTGGTGCTTATTCTAG
TTTGGTTGGCAGTTAGAACTTTTTATTTGTAAATATGGTCCAATCTGTATGGGTGTGTGT
GTGTGTGTGGTGAAACGGAACCAATTGCGCGGCAAATAAAATCTGCTGATTTTGAAAACC
AA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TTTTGTTGATATATTGTTATACCTATCGGGGCTGTATGCATCGGCAATCGCATGGGCACA
GCTAAGGCCGGCCAATTCCATCAGCTGATCGACGCTAAACTTGTACTCATTGAACAGTTC
CTCATCGACACTGATCGCTTCCTGCTGGTTAAGATATTTCATCGTGCCGTACTGTGCCCT
ACCAGCGGTCAGAATATGCTTATTGCTATGTCGGACTGTTTGCTAAAATATAATAAAAAT
GATAAAATACACTATTGCAACAGGAACACGACTAAAATCACTTACAACGCTCGAGAAGAG
AGCAAAATTTTGCCTTATCACTCGCAACAACATACCGGCGCATTGTTTACATATTTGACA
GTTTGCGTACCAACAGCCGCCTGCTAAAAGCGGCCAGCTTGACAAACGCCTTTTTTGAAT
CGAAAGAAAATGGACGGTTATTCTAAGTTTAGTTTTCCTGTTTTAAATCAGTTCACAACC
AATATTGATATGTTTTAGAATTGTATTACTTTTCTTTGCTCTATATGCTTTTCCATAACG
TCATCAAAATAATTTACCCATTTTTTTATCTTATTGCAAGTAGCCCACAAAATTATCAGT
AAATTACTTTCCAGCTTTGTTTTGATATTCGTATCTTTTCGCAAAAATATGTTCCTGCCC
GACTCAGAGTGGAAACAATCCCCACAACCCCGCCAAACCGAAATGCACCTTGCTCCCTCT
AGCCATGTTTTGTGTTATCTATACTTGCGAATATTTTCGCTAATCGCCTGATAAGGCAAT
GATCGAACGCATCCGTGCAAAACGCATACAAACCGGTTTGGCAACGTGTGTGCTAAATCT
GTACTCCGATAAGAAACCAATTAAGATAAGGCCAATTATTTAGAGAGGATGCGATTGCAA
CGCATATGAATGCCGCCGGTGCAATTCAAAACTTAAACGCAGTAGAGCTCCCCCTTACGC
TGTCCCTCTATCGAACCGATTCAAAACTATTCATCTGTCAAACCGCATTACGGACCGACT
GACGTACGGAATCTTTCTGCTCGCAATCGCAATTGTCCATTTTTGCTCCGCCAGTGAAGT
GTCGGACTATTTTTCACTCCTAAAGTTGTACTTTTCTGCAAGCGCAAGAAAACCCATATC
CTCGGCAAG
ATGCAGGGACTAACGATGGCTAGTTTGAAGAAAAACCCAGCGGTAGGTAAT
CGTACTGGCGTGATGTGTGAAAATTGCGACCTTATTGGTCCATTTTGTGTGGTTACGTCA
CGAGTGTTTGTTGGAAGGGCACGATATGGATGGCGTGAAAAATGGTTCTGCCCAGTACCT
CTTGTTTTTTTCCTTCTTCTTCTTCTGCTGGTCACAAGTGCTTACTAATCACTTTCATCC
CCCCGCCCCCTTTCCTTTCCGCAGCTGATCCCGCTGTACGTGTGTATCGCGATGGGTTCG
GCTGGAGCCGTCTTCTACACCCTTCGTCTGGCGCTGAAGAGCCCCGAAGTTACCTGGAGC
CGCAAGAACAACCCCGAGCCGTGGGAGGAATACCGGACCAAGCAGCATAAG
GTGACCCGT
CGCGTCGCGTTATATAAATGTGTGGTGCAGCAATTTCAAAACGATCCACCCTCCCCGCGA
TGACCCCGGCTGTCCCGCGAAGGAGGAGGCTCTATTTTCGTTTGAAGCGACCACTTATAA
TTAGATGGAACCGTTCGCTCTGGTTCGGAAGGTTGTAAACAAATGCACTGATATCGACCC
TCTTTACACTTTCCACTCTCGTGTACAGTTCTACTCTCCGGTCAGGGATTACTCCAACAT
TAGCAGCCCGGCCCCGAAGTACACCGACTAA
AGTGTCAGCATATTGTCAGCCACCGAAGA
GGCGCCACCGGCTATAGAATGGGGACGGGGAATCACCACTCTAATATATACCCTAGCATC
AATAAAACTGGCCGCGGAACGACAACACCGGACGCCCATTCTCCCTCCCCTATAGTAGTG
CAGATGTATTATTTGTCATTTGAGCAGCCGCTGGAAAAGACTCAAAGGATAAACGGAATT
CGATCGACTAATTGGAACACATTTAGCACGCAGTGATGAAGCGCATACTTTGGATAAACA
ACATCCCATCCCAAAACAACAAGACACGGGACGATTGGTGCTTATTCTAGTTTGGTTGGC
AGTTAGAACTTTTTATTTGTAAATATGGTCCAATCTGTATGGGTGTGTGTGTGTGTGTGG
TGAAACGGAACCAATTGCGCGGCAAATAAAATCTGCTGATTTTGAAAACCAA
GCCGGTGA
CGGAGCGATGCAAACGTTTATTTGTGGTGGCCATCTATTTTCGGCTATGGATGATTGTTG
ACTGGCATTGTTGTTTGCTGCCTTACTTTGAACGATTTGGTAAACAAGCAAGTTCGATGC
CCGCGCACCTTGTACTTGTGAGATTTCTAGCACCACCATAACACGACGATCGAGAGTTGA
TGTATTTGAAGTGAACTTAATTTCAAGATAAGGGTACATTTCAGTTAATGGAACTAGGGG
CATATGCGATTTATTACGACTACCCAAGCTAGGCGTCCGCCTGTGATCAACGATTGAAAA
AATGACCGTCCCATCTCTCTAAAGCACATTTTCATCTTGTGATTTGTCCAGTTGAGGATC
TTTTAATCAACCTTCCCGCTGGACGCTACATTCTTGTGACCGCTTAGAGCCTTCACTGCT
TGTAAATTCAGAGTAATGGATAAAAAAGCAAGCTACAATGAGTTTACCTTACGATCGATA
CGAAAGAAATGCAAAGCGTTAAGGAGACTATCCTGGATAATTACGCAACGAAGGGATTGG
AAAGCAAGGATTATAACGACACCTTTTGAATCAGAATCGAATATATAAAACGAAAGAAAT
GCATGCAGTTGAAGATGCATTAGTTGATTTCAACCAATCAGTATCAGTCGGATTGGTAAT
GTTTGGTAAAGAAGTCTAGCAAGCCCGCGTATGTTCCCTCTCATTTCACCAAGAGAAAGA
ACCTACCCAATAAGATCGGCTAGCTGATAAAAAGAGACCAAATTAACCATCTTGCCACAA
GCAAGTACGACAACTTATTTAGAATATATTAAAGCAGTTAAAAAACTTTGAAATTATCTG
TTTTGAAGTAGTCCAGATTATATTCTCTCTTATTCTCTTATGTTATAATGACTAAGTTAT
CATTTAAAAAATTTAAAAGTCGTAAGTGTCCTTGAAATTCAAAATCATAGAATTTGTTTT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004