login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG8680
Organism Drosophila pseudoobscura
Gene Name Dpse\CG8680
Product NADH-ubiquinone oxidoreductase 13 kDa-A subunit (NUMM) (By similarity).
GENE MAP
Chromosome pseudo4-mel2L
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig1006_Contig943 The following contributed to reference sequence development: bases 1..2460 - Contig1006_Contig943  568522..570981
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is a component of the iron-sulfur (IP) fragment of the enzyme.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class  --
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
SwissProt AC  --
View Sequence REFERENCE SEQUENCE
Contig Contig1006_Contig943
Sequence Location 568522..570981
Sequence Lenght 2460bp
Relative Gene location 985 .. 1496
CDS
CDS Location 985 .. 1496
Sequence Lenght 126aa
Translation MASKQLVNNFAKVGRCGQNWLAPLTAVRNNSSRSDIDKVTHTGQVFDKDDYRNVRFVNAK
RYVNENWGIKMIEDVPPIESTERVVFCDGGDGPLGHPKVYINLDAPGSHTCGYCGLRFVK
KDDHHH
CDS region ATGGCCAGCAAGCAATTGGTAAACAATTTTGCCAAAGTTGGACGCTGTGGCCAGAACTGG
CTGGCTCCATTGACCGCCGTACGCAACAACAGCTCCCGCAGCGACATCGACAAAGTCACG
CACACGGGACAA
GTCTTTGACAAGGATGACTACCGCAATGTGCGATTCGTGAATGCCAAG
CGTTATGTGAACGAGAACTGGGGCATCAAAATGATTGAAGATGTGCCACCAATCGAAAGC
ACCGAGCGTGTGGTCTTCTGCGATGGCGGCGATGGCCCCCTGGGACATCCCAAAGTGTAC
ATCAATCTG
GACGCTCCCGGCTCTCACACTTGCGGCTACTGCGGCCTGCGTTTCGTGAAG
AAGGATGACCATCATCACTAG
mRNA
mRNA Location 985 .. 1496
5'UTR Location  --
3'UTR Location  --
Exon < 985..1116,1195..1371,1425..1496 >
PolyA Signal  --
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
ATATGTGTATATGCTTGGATGGCAGGTAAGAAGACTTTTTCTATGAAGAGCTTTTTTAAT
ATTGTTGAGGAAAAACCGAGAACAACACTCGACGAGCACGAAACACTAACTGAAACGATT
CCCCCAGTGCCAGGAGACAGGGCCGGGCCGCCGTGGCCGATCTTGGGGAAGATTTTCGAA
CAATATTCGGGGGAAAACAGCAGACACAGAGATCGGCAACTGCGCACGACGCTGTGTCTG
TCTGTGCTCTCTCCCTCTCGTAGAATTTTCAGCCGGCTCCTCCATTTCTGTTTATATTCC
TGCATTCTAAACAGAACGTATGCGCGAGGCAAGTTTCGGATAAAGTAGCGGTACAAGGAA
AATCAGCACAACTGGCAGCACGTACACATACACAGGCAATTTCGTACAGCCGGCATAAAA
CTGGCAGAAAAACGCCAAAATATACTTCTAAATAGCAAACGCATGCATTCCCCGTATGCA
TCTATGTTTTAAACAATACTTACAGGTGCTTAGCTTTCTTTTTGTCCATTTTTTGTAAGT
TTTAAATCGTGAAAACACACAATAAAGTCGCCATTTAAAAAAAATGCGCGAAAGCACTAA
AAATGGTAGTCAGCGATGGGAGCGTCACAGCGTCAAAAAAGGGCTATCGCGTGAAAAAAA
AGTATGTGCATAAAACGGTAACAAATAGCACAAAATAAGAGATAACCACTTCATAATACT
ATACATTACACCTCAAAATATCTAAAACCACTTGTTTGTATTGTACATCCAATTAACAAA
ATATTTCCCGCCGGCCGGCAAGTCAGCATTAAATTAACCGTTGAAATTAGAGGTGGGGTG
GCATCGATATGTACATCGATATGTTCAGGCCGTGCTGTTAAGCGCAAAGTCTTAACAGCA
CATAATGTTCTGTCAAGAGCACTGCAAAACCAGCTGTGTCTGTTCTATCAAAATATAAAT
TGTCTGAATAAATTTTTTGGAAAAATGGCCAGCAAGCAATTGGTAAACAATTTTGCCAAA
GTTGGACGCTGTGGCCAGAACTGGCTGGCTCCATTGACCGCCGTACGCAACAACAGCTCC
CGCAGCGACATCGACAAAGTCACGCACACGGGACAA
GTGAGTAGAAAATGTTGTGGCCGT
CCTGCGATTACGCAAACATTTTTGATTTTATATCCAAAAATTATGCTCGTTTAGGTCTTT
GACAAGGATGACTACCGCAATGTGCGATTCGTGAATGCCAAGCGTTATGTGAACGAGAAC
TGGGGCATCAAAATGATTGAAGATGTGCCACCAATCGAAAGCACCGAGCGTGTGGTCTTC
TGCGATGGCGGCGATGGCCCCCTGGGACATCCCAAAGTGTACATCAATCTG
GTAGGACAT
ATTCTATTGAATATCTGCGGATCTTAAACAATCTTTGGTTATAGGACGCTCCCGGCTCTC
ACACTTGCGGCTACTGCGGCCTGCGTTTCGTGAAGAAGGATGACCATCATCACTAG
GAAC
TACTACCATCTTGAGAGGCCTGGGTCTGCCCATCCAATTGCTTTAGTTTAAATTTCAAAC
TGAATAAAATTATACCACAAAATGGCTTTGGCTGCGACTAAGAGAAACGGAACACTTTTG
GAGTGCACAGGATTTTCCAGATATAAGATATACTCTTGTTTGATTCAGGAGTGATTTCTT
GTGTTTGTGGTCCAGATTGTGGTCTAACCTTCACGAAAGAAGCAGTCAGGGAAGTAGGGA
AGTACCTTTGGTACCTTTTCGATTAAATTCTAAATAAATAAATACAAGAAAATACCTGCT
TTGTAGTGCTTGGGACAGTTCGGAATGTCTCAAGTGGATAGGGCTCCCCACTGACTACAG
TTGATGAAACTTACACCCGAAACAGGGCATGGCCGGGATCCTATTAATCGTATTTTCGAC
CAGTTTTGGTAGACCTGTTTCCCATTATTATTGGCAAACACTTCGTTCTAGATGGATTTT
TGCCAGAAAATAATTCTGGAAACTAATCAAACATACAAAACAGGACTCTCAAGATTATAG
TTACTTAAAACACTTCCCAAAAGCACCAAATAAATACATTATTATATTGCACAACACTTT
ATTTGCATGTATTTTGAATGATTTCTAATGCGTGCATGCATTATAGCCATTTGAAAGATT
AGATTTCATTAAACTCAACTTAAACGTTACAGATTAGTACAACTTATAAATAAACAAATT
AAAGGTAGTATAATCCAGAGTTAAATTGAATAAACTGTGAGTTGAACTCTCGAAACTGGC
GCTGCAGTTTTTGTAGATCAAATCACCAGGTGATTGGTGGGGGTGGGGGTCTGTGTGTCT
TTCTATATATAATTTTTATGTATAACTAGTAAATCAATTAAATTATATATCAATGATAGA
TTGTGTGTAAATCGTTTGCCTGGTAAGCGGTAATACATATGTTGTATAGTTGGTTGGTTC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004