login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG6463
Organism Drosophila pseudoobscura
Gene Name Dpse\CG6463
Product NADH-ubiquinone oxidoreductase 13 kDa-B subunit (NUFM) (By similarity).
GENE MAP
Chromosome pseudoXR-mel3L
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig3045_Contig6170. The following contributed to reference sequence development: bases 1..3100 - Contig3045_Contig6170 6801..9900
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is a component of the iron-sulfur (IP) fragment of the enzyme.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class  --
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
SwissProt AC  --
View Sequence REFERENCE SEQUENCE
Contig Contig3045_Contig6170
Sequence Location 6801..9900
Sequence Lenght 3100bp
Relative Gene location 1599 .. 2152
CDS
CDS Location 1599 .. 2152
Sequence Lenght 124aa
Translation MAKIIKASTGLTGLAVSTNPHHTLCALYGKILRAVAKMPQEASYRKYTEQLVKQRADAVA
NNKDIVALEKAVGCGQVEELIVQAENELVLARKMLGWKPWEKLSQAAPAKQWDWPPAQIL
EPKV
CDS region ATGGCTAAAATTATTAAAGCGTCCACAGGTCTGACCGGCCTCGCCGTGTCCACCAATCCC
CACCACACGCTGTGCGCGCTCTATGGCAAGATCCTGCGTGCAGTGGCCAAGATGCCACAG
GAAGCCAGCTACCGCAAGTACACGGAACAGCTGGTCAAGCAGCGGGCCGATGCCGTGGCC
AAC
AACAAGGACATTGTCGCTCTCGAGAAGGCTGTCGGATGCGGTCAGGTGGAGGAGTTG
ATTGTGCAGGCAGAGAACGAACTGGTGCTGGCACGCAAGATGCTCGGCTGGAAGCCCTGG
GAGAAGCTGTCCCAGGCTGCGCCCGCCAAGCAGTGGGACTGGCCACCAGCCCAGATCCTG
GAGCCCAAAGTTTAG
mRNA
mRNA Location 1599 .. 2152
5'UTR Location  --
3'UTR Location  --
Exon < 1599..1619,1737..1898,1961..2152 >
PolyA Signal  --
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GGTACATATAATATATCATATCACGAACTTGACTGATTTGCATATTTATCAGAAAACAGT
CTGGGAACAGAAGCTTTTTGCATAATAAACTGCTTTGCGATTGTAAACAGTGAGCTTATA
GAATGAGAAATTTCCACATCATAAATCGTATTCAGGAAACGCTTTCATCTATTCTGTTTT
TTATTTGTAGGAAAGCATAAACAATCGCAGCCAGAACGATGCAATCGACGGACGAGGAGG
CAATCGCATACCCCGAGCAGGTTTGTATTTCCACCTACCTCACTAGTTTCTTGATCTTTA
AATGTAAATACGTACAACATGTACTGTGTACATTATTCTCTGCTTATTTATGCTATGTGT
TAATCTTGTCTTGTTGCTAATGCCGCCTTTAAACCGCAATTTATTATAACTTTAAATCGT
TTATGTGGTGTAAGTAGAATCATCGTCCAGAGTAAAGCAACTGAACATTATAGGTTTCCT
CTTACCTTTTGGCAGTACCCGAAACGGATGACGATGACGACGATCGTCCCTTCGTTCAAG
ATGGCAATGGCAATCCAGGCGTGGACGATGGCCTCCTGGGAAATGGAGGAGGCGGCGGCG
GCGGCGGCGGTGGTGGTGGTGGCGGGGTCACTGTCCTCGTCCCCAATGGCGGCAACAAGG
GGGGACGACGTCCGAGCTACATGTTTCCTGGTTACAGTGGACCCGAATTCGTGAACATCA
ATGGCGTGGAGACGCCCATACCTGATGTGAATGCCTACCAGCACAAGAAGACCTTGGCCC
AGGGCATGATGGATCTGGCACTGCTCTCGGCGAATGCGAATCAGCTGCGTTATGTGCTCG
AAATGAACCAACAGCACCCATACTTTTATCCCAGTCTGTTGTTCATCTCCCTGAGCATTA
TATTCCAGGTATTGCGGATGATTTGCATATTAATCGCGTATTTTAAAATTCTTTTTTGGC
ACTGTCTCATTGCAGATCGCAGTCGGCGTCGGCCTTATTTGGAACGGCAGGTACAACATC
AAGAATGAGCAAGAGATCTGCCGGGCGAACAAGATCAATAATTACACAGTCATCGGCATA
TTCATTGTAACGGTTGTCAATGTCTTAATATCAGCCTTTGGCATCGTCGAGCGTGCCCCA
GGCCCAGCATAGTTTGCAACTGGATGTATAATATCAATAAGAGTATTAGTATGTAGTAGG
ATAAGCACCCCACACATCAAAACTCGCCGCTACAACTACCAATATTTTTTTTTGATAATT
TAGTAATTTTCAACCGTGTTTATATGATTGAAAGAATTACTTGGCTAACGCCAATCGCCT
CATTCTTATATACATATGTACTATTAACAAAATTGTGATAAATAAATCGAATCCCAGCCC
TCAAAACAGGTTTTGAATTTCTTAAAAGGCGCGTTATTTGGGAAAACTATCGCCAAGCAA
AGCGATAACTATTGGTATCGTTTCGGCACTGAAAGTGCCGTTTTGCGCCATTTTACAGCA
CTGATACAAGTCAGGTTGGCAGCCCCGTCAGCTGTTGTGTTTTTGTACCAGAAATTGTGC
AGAAATTTAACAAATTTGTCGCTTTCTAGCTCATAAACATGGCTAAAATTATTAAAGCGG
TAAGTAGTTTGAGCCGCCGTCAGTTCGAACCATTTGGAGTTACGAGAGCGGCTGTGAAGG
CAGCCGCTCTATTGAATCCTGGTATCGTGTCCCAGTTATGTCATCGCTTCCTACAGTCCA
CAGGTCTGACCGGCCTCGCCGTGTCCACCAATCCCCACCACACGCTGTGCGCGCTCTATG
GCAAGATCCTGCGTGCAGTGGCCAAGATGCCACAGGAAGCCAGCTACCGCAAGTACACGG
AACAGCTGGTCAAGCAGCGGGCCGATGCCGTGGCCAAC
GTACGTTTTATTAATGATTAAC
GATGTCCTGCCATAATTTCACTGATCGATGGTCATTACAGAACAAGGACATTGTCGCTCT
CGAGAAGGCTGTCGGATGCGGTCAGGTGGAGGAGTTGATTGTGCAGGCAGAGAACGAACT
GGTGCTGGCACGCAAGATGCTCGGCTGGAAGCCCTGGGAGAAGCTGTCCCAGGCTGCGCC
CGCCAAGCAGTGGGACTGGCCACCAGCCCAGATCCTGGAGCCCAAAGTTTAG
GCTTCTTT
TATCCCATTATATAGTACTAATTAATCTATTTTGGAGTGCCAGTGCCGCTAGCAATGACA
TCGTTCCAAGCCTTGTTGACAGAAAAATGAATTGTAAACCGCAATAAATCTGTTGATTGT
GGATTTCACTGATAAGCCAGCCAGCCCCACACATTTCAACCTAACATCTTTGAGATTTGA
TTGAAGCTCGACTCTCAGTTTGTTTTCAGCATGCGCGCACTTCACTACCTTCTGCTGCTG
CTCATCGTGTTCACTGGGCTCGTGGCGGCGGCTCCCACTTCGCGCCAACGGCGTCAGATA
GACTTGACGCTGTCGGCGGATCATGATGACACGGACCGCGAGACGGAGCTGGCCTTGGAG
GCCATAGCCGGACTCTGGAGCAGTGCTGACAGCCGCACCAAGATCGACGGATCAGCACGA
GTGGTGCATCGTCACAATTCAATGCAATCTGGTACGGGTAAAACGAGCTACACGGCACGC
GTTCATCTGCATCATGACTATAAAACCAATGCGTATCCCTCGTAATCCATGTACATGTCT
GTGTCTGTGCCAAGGTTCGGAACAGGATTGGCGTTTGGGTGTGCGTGTCGTCTTCACTTA
GGCTTCACCACTTATCCTGTCTCCAGACACAGGTCAAGGTTCCTGCGGAATTACCAGTTG
GCGTGCTCTCCCTCCGTTCGATGGACAATAAATCTACTAACCGTACTGTTCGTGGAAGAT
TCCTGATAACTTTTTGACCTTCAACGATAGACTTGTAAATAGAACGTTCGTGAATACAAA
ACCAAAAGCTGGCTGTTTGCTTTATTGATTCCGTTTTAATTGGCTCCGAGTGCCGGAGCG
TGAAGTACCGCAACAACTTTCAGCTTAAAATTACAACAACTAATTGCACAACAAAGCAGT
GTGGGGTCACCGAGGATAATAAATAAGATTGGACGCTTAA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004