login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG11455
Organism Drosophila pseudoobscura
Gene Name Dpse\CG11455
Product NADH-ubiquinone oxidoreductase 15 kDa subunit (NIPM) (By similarity).
GENE MAP
Chromosome pseudo4-mel2L
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: >Contig284_Contig6045 (WGS as of 2003 08 28). The following contributed to reference sequence development: bases 1..2400 - Contig284_Contig6045 544203..546602
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is a component of the iron-sulfur (IP) fragment of the enzyme.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO  --
SwissProt AC  --
HGSC (Dpseudoobscura) Contig284_Contig6045
View Sequence REFERENCE SEQUENCE
Contig Contig284_Contig6045
Sequence Location 544203..546602
Sequence Lenght 2400bp
Relative Gene location 1023 .. 1393
CDS
CDS Location 1023 .. 1393
Sequence Lenght 101aa
Translation MSLTPFLRLPLTDLTGCLINHQTYDKCGKFEMKMMDCLEAYGLERGKKECADLIADFQEC
VGMNKQLMRFHAMRNERYKQWLLGERKKAELFAEAPRVDAY
CDS region ATGTCTCTGACGCCCTTCCTGCGCCTGCCCCTCACGGATCTGACCGGCTGTCTGATCAAC
CATCAGACCTACGACAAATGTGGAAAATTTGAAATGAAAATGATGGACTGCTTGGAGGCC
TACGGCCTGGAGCGCGGCAAAAAGGAGTGCGCCGATCTCATTGCGGACTTCCAGGAGTGC
GTGGGCATGAACAAGCAACTCATGCGTTTCCAT
GCCATGAGGAACGAGCGCTATAAGCAG
TGGCTGTTGGGAGAGCGTAAGAAGGCTGAACTCTTTGCTGAGGCACCGCGCGTGGATGCC
TATTAA
mRNA
mRNA Location 1023 .. 1393
5'UTR Location  --
3'UTR Location  --
Exon < 1023..1235,1301..1393 >
PolyA Signal  --
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
ATCCACGGGAGATTTCAACGCGTCTCAATGCCTTGCCGGGAAAGGCCGCACGATTCAGTT
CCACCAGTTTGTCCACCTCTTCCTCCTCCACCTTGTGTCGCAGATCAATGCTGATCACCA
GTCCATTGGCATCGTACTTCTTGTCCAGCTTTTTGCATATTATGGGATGTAGAATCAGCT
TCACCGCCTCCTTGATGGGCACATCTGGCGGGGAATTGCTGTGAACAGTGGATCCAAACT
TCCTCTGGAGGGCAAACCACATGGAGAGCTGTCGCAGCTGCAGGCTCATGGGCATTGTAA
TGGCCAAAACGATGCCCTCGCTATCATATTTGCCAAATTCCGAAGCGATGATGCCCTCGA
TCAGCTCCCGCTGAAAGTCCTCGGAGAAGATGCCCAAACAGGTTGAGCAGTGGCTTAGAC
GGGGCTTCTTGAGCGGCTGTTCGTCTGTGGAGATGACATTATCTTCATCTTCTACCTGAT
CTTCAGTCACTTTTACTCCCAGCTGTAGAAAAGTATACGTTTGAAATATTGTCTTGCCAG
TAATGCCTATTTTTACTCACCCGCTGGAGAGATTTGTGGATATCATTGTACTCGGAACCG
CGTGCCCTCAGATAACGTAGCTGACAAACCTTGCAGACGCCACAGGACATCAAATAGTCC
ACGAGTTCTTGGTTTTTCATTTTGATTTAAACAAAACGTGGAGTGCGTCCGGTGCCGCTA
AAAGCACTATCAGCTGTCGGGCGATTCAAACGTTAGCCAACACTTAGCGCTGGTCGGTTT
AAGAAAAACACGGAAAGAAATTGTTTTCATTGCCAATTTATTGGAATTTAAGGTGCGTGG
CGAGTGAATTTATAAGAAAATCCTACAAAAGAACGAATTAAATGAGCAAATTCACTATTT
AAGTCTAATTGCAAGCCAAAGTGTGCCTTCTATGAGCTTTGTTATGGTTACGTCACAGAA
GGAACAGACAAAATCTCCATACTGACTCTCATGGATATGTTTTTTTTTAATACGCAGGCA
ACATGTCTCTGACGCCCTTCCTGCGCCTGCCCCTCACGGATCTGACCGGCTGTCTGATCA
ACCATCAGACCTACGACAAATGTGGAAAATTTGAAATGAAAATGATGGACTGCTTGGAGG
CCTACGGCCTGGAGCGCGGCAAAAAGGAGTGCGCCGATCTCATTGCGGACTTCCAGGAGT
GCGTGGGCATGAACAAGCAACTCATGCGTTTCCAT
GTGGGTTTTCTTACGTCTAAGTAGC
AAGGAATTGCTTAAAACTTCATTTTAAATCTCTGTTTTAGGCCATGAGGAACGAGCGCTA
TAAGCAGTGGCTGTTGGGAGAGCGTAAGAAGGCTGAACTCTTTGCTGAGGCACCGCGCGT
GGATGCCTATTAA
GAAAGGGAGCAATTTCGTGTATAACTTCATATGAATAGCCGCAAATT
GTATAAAAAAAATAAATAAAATAAAACGAAATCTGTATCATCTGATTTGGACAGTCTGGC
AACCCTCCCAATAGTTGAAGTGCTGCACAATGATTCCAGAAATATTGAATTTTGACTCAT
TGAATAAAAAAATAATTAAATAATAATTGTAATAAAACTCTAATTCAATGCGAATTTTTT
TATAATAGTTTAACAGAGAAAACTTGTAAAATAAATAATGGAAAATTAGTATCGCAGTCT
GGCATCACTGGCTGACATCAAATTGTCACCTCTAGTTGTTTTTTTGCCGAAAAAATTTCT
GCCTTCTACGAATTTTGTAATATTTCTGTATAAAACCAAATAAAATGGGCACTAAACGAC
CCCACAACAGTGTGGTACCAGCCCAGGAGACAAAGCGCAGTAAAAATGATATAATAGCAT
ATACAAATCGGGATAAAGCGCTCTTGGAATCGGTAAGCGTGGTGGAAAGAAGAAGCATCA
GGATTTCCCTATGGAAATTTGTTAAATTTGTTATTTTTCAGGGTGTAAGAAGAACATCCA
ATCTGCAGGCACCCATAATGCAATTGGAGGGACATGAGGGAGAGATCTTTACGACAGAAT
TCCATCCGGAAGGAGAACTTTTGCTGTCATCTGGCTTCGATCGCCAGCTTTGTAAGAAAA
ACCCATCTAAAACCATGGGAAACACACTACCAGTCAATTTTCATTTAATTTCCCAGATAT
TTGGCAAGTCTATGATGACTGTGAGAATGTAATGGCCATGTCCGGACACACTGGAGCCGT
GATGGAAGCCCATTTTACCCCCGATGGCTCCCACATCTTCACCTGCTCCACAGACAAAAC
GCTGGCCATTTGGGATATAGTCACGGGCCAAAGATTGCGTCGTTTCAAGGGCCACACGAG
CTTTGTGAACAGTGTCCAGGGCACGAGGAGGGGACAACAGCTGCTGTGCTCCGGCAGCGA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004