login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG13302
Organism Anopheles gambiae str. PEST
Gene Name agEG13302
Product NADH-ubiquinone oxidoreductase 15 kDa subunit (NIPM) (By similarity).
GENE MAP
Chromosome 3R
Celera Gene agCG55095
Citogenetic Map 35C-36D
Gene Map
Comment This record is derived from the following: gb|AAAB01008980.1 >gb|BX038214 5', mRNA sequence . The following contributed to reference sequence development: bases 1..2886 - AAAB01008980.1 7675119..7672234.
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is a component of the iron-sulfur (IP) fragment of the enzyme.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class  --
EXTERNAL RESOURCES
GO  --
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000013302
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008980.1
Sequence Location 7675119..7672234
Sequence Lenght 2886bp
Relative Gene location 996 .. 1886
CDS
CDS Location 1364 .. 1775
Sequence Lenght 101aa
Translation MSLGPFFRSPFTDLTASMVNFQQYDKCGELEMASIDCLEAYGTVRGAKKCADLLADFQEC
AFMTKQIARFRAMRMERHRQGWNGERKGDGYYAPPPRVDAY
mRNA
mRNA Location 996 .. 1886
5'UTR Location 996..1031,1335..1363
3'UTR Location 1776..1886
Exon 996..1031,1335..1576,1683..1886
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
AGTGGAAAAAAACATCCCTGTTCGTGATTCGACGAGCCAGTCATCCCAGCAAAAGCTAGC
AAAAG
ATGTCTCTTGGACCGTTCTTCCGCTCACCGTTCACCGACCTGACCGCGTCGATGG
TCAACTTCCAGCAGTACGACAAGTGCGGCGAGCTGGAGATGGCTTCGATCGACTGCCTCG
AAGCGTACGGTACCGTGCGCGGTGCGAAGAAGTGTGCCGATCTGCTGGCCGACTTCCAGG
AGTGTGCGTTCATGACGAAACAGATCGCTAGATTCCGG
GCAATGCGAATGGAAAGACATC
GTCAGGGATGGAACGGTGAGCGCAAGGGCGATGGATATTACGCACCACCGCCGCGTGTCG
ATGCCTACTAG
AGAGTGCGTTAGCTGTGAGCACATCCGCAGCACGGGAGGCACCACCACT
AGAGGAATCCGCCTATTCCTTGTAAATTAATATTGAAATACATTCATCCGTTATATAGAC
AA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GTCGTGGTGGTGGCCGCGGTGGCACTACCAGCACAACGGTCGGACAGACGTTGCTGGACG
ATACCGAGTGTTGGGACGATTCGGACTGCAAGGCGTACGATCCGCTGGAAAGCTGCCGAG
CGAAAAAGAACGAAAATGCAGCCTTTATCACACCGAAGATAAATCAGTTTGTGGAGCAGC
GAACGGCTGCCGCTGTACTGAAGAACGACAGTGGGACGAAGCGAGAACCAACCTCGGACG
AAGAATTCGGTAGCAGTGCACTGAACGAGCGCCAGAATGATCTTGAACAGTTCGGGCTGC
GACGAAACGCTTCACACGGCGCGAATGCTGGAAGAGTTGTCAGTGGCCGGTATGGCGAAA
TAAAGCAAGAACCAGGTAGCTCGGGCAGTAGGGAACGTGATGATAGACATTCCGGAGTGC
GGTCCAACTCTCGCAGCGGGTATGAAGCGGGTGAACGGAACCCGTACAGTAGACGATCGG
ATAGCGGTGGGTATCACGATCGAGAGCGGCACGGATACGATCGTCGTAGCGATGGATATT
CGAGCAGAGACCGGTACGACAGTCGGCACCGTAGGGATGGGTATGATTCGGAATCTAGGA
GCTCTCGAGGATACGGTCGAAATGACGATGATGGTTCCCGCAACCGGGGACATGGCAACG
ATAGGTACCAACCGTACGGAGGTAGCTCCTATCGATCGCACAGAACGAGTGATTCCACCG
AACGAGGTAGTGACTATTCTGCGAAATATCCAAACCACGAACGTGACCATTAATTTTAAC
GAAAAATCTGAACTGAAATAATGCTGTTAGCGGTACGACTTAGCATAGAACAATGTACAA
TGAAGGAAATGAATGGAATTATTTTTGCGAATAAACATGCAACGGAAATTGCAAACGCTA
TCGTAGCATAGTCAAATACTCTTCTGTCTGGCAACACTGCTATCAAACGGAGTTTGACAC
GTCTGCTGGCTGTCAATTCGGAAGTTCCAAAAGCGAGTGGAAAAAAACATCCCTGTTCGT
GATTCGACGAG
GTGAGTTTTTATCGCAATCTACTCTATTAATTTGTGGATTTTACTTATT
TTAAAGGCACGCAGATTATACGTATGCAGTGTGTAACTTTCTCCCGTTGTGTCTTGCTAA
AGAAAAGCTACAAAATGCCGTATTTCGTGGTGTATTTCATAGCGTATTCGGCCGCAAGAC
AGTGACGTTACATCACAGTTGCTTTATTTTGATGCTGCACCAAACGAGAGACTTGCATCC
TTGGGAAACAAACAAATTTGTTTAATTGTAGCTTACCATTTCCCGTTTTCCACCCCGTTG
GTTTTCCGTTCCAGCCAGTCATCCCAGCAAAAGCTAGCAAAAGATGTCTCTTGGACCGTT
CTTCCGCTCACCGTTCACCGACCTGACCGCGTCGATGGTCAACTTCCAGCAGTACGACAA
GTGCGGCGAGCTGGAGATGGCTTCGATCGACTGCCTCGAAGCGTACGGTACCGTGCGCGG
TGCGAAGAAGTGTGCCGATCTGCTGGCCGACTTCCAGGAGTGTGCGTTCATGACGAAACA
GATCGCTAGATTCCGG
GTATGTAAACAAACCCTTCCTTCTGGAGGGGCTTAGCCATCAAA
GTGCGCGTTTATTTAAAATGGTCTTTCCCGAACGGTGCTTTTTTCTTTCTTTGCTCCCAT
AGGCAATGCGAATGGAAAGACATCGTCAGGGATGGAACGGTGAGCGCAAGGGCGATGGAT
ATTACGCACCACCGCCGCGTGTCGATGCCTACTAG
AGAGTGCGTTAGCTGTGAGCACATC
CGCAGCACGGGAGGCACCACCACTAGAGGAATCCGCCTATTCCTTGTAAATTAATATTGA
AATACATTCATCCGTTATATAGACAA
TTTCGGGAATTGTTTCCAAAAACCGATGATTACA
TCCCGACATTATTGTAGAAACGACACGGGGCGCTTTTGTACGTTGTACTCTTCATTGATC
GGTAAGCATGGTAGGGTGCCTGTGAACAGGTCTTCATGAGTATTCTATTTGGTGTAATGA
CATACGCAGTCATGTCAGGCTTTACAGGCTTTTCAGACATTTAATTAATTCAAATACAAC
GCAGTCGGATTGCGTACGACATCCTACTTCAAAAATTCAACAATTCTTTTAAGATTCATA
CAAATCTTGAAACGATTATGGAATATCTAAAGATCAATATCTTCAAAGATTCATGAATCG
TTGAAAAGCTCGGAAAACGTCAGCGGTCGCAATTTTCATCGTACGTGTAGTAGTAGCCTA
AGCACGAAGACGCCCTCGAACATGACCAATAAGCGTTCTGCAATAGTGGGTTGCAAACAT
GGGTTTAGGATACATCCCAGAACCCGTATGGTTTGGTGATGTGTTCCAGGATTGGAATGC
ATTCAGGATTTGTTCTAGGACTCGCATGACTTTTGGATAAGCTTTTAAGCTGGTATGCAT
AGGTGCAGGATCAGTTCCACGACCAATACGGGTTCAGGAATAGCTCCAGGGCCTGTATTG
GACAGGATTAGTTTCACGAACGGTATGGATTGAGAATCACTACCAGGAATGGCACTAGAT
TAAGTATCAGTTCTAGGACCTGGAACTGGATTCGAGATCAATTTTTGGGCCATAGTGGTT
CCCCCCGGCACCCAGGATGAATCTTCAGATTAATTGTTTCTTCTTAGAAGATTCACTGAG
GCACAGAAACCTCCATTGGTCATTGTTACCGTTTTGCAGCAGCGGGTCATCAACAGAAAG
AACAAAAAAAAACACACAACAAAAAACGGTACATTCTGTGTTTGTGGTTCATTTTTAATG
TTTCTTTTTTTCTCATTCTTTTCTGCACTCCTTTCTCAAGGGATGAATATCGGGGGGGAG
ATTATG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004