login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CD2286
Organism Drosophila pseudoobscura
Gene Name Dpse\CG2286
Product NADH-ubiquinone oxidoreductase 75 kDa subunit (NUAM) (By similarity)
GENE MAP
Chromosome pseudoXL-melX
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig4832_Contig7452 (WGS as of 2003 08 28) The following contributed to reference sequence development: bases 1..4500 - Contig4832_Contig7452 546043..550542
PRODUCT
Function This is the largest subunit of complex I and it is a component of the iron-sulfur (IP) fragment of the enzyme. It may form part of the active site crevice where NADH is oxidized.
Subcellular Location Mitochondrial matrix and cytoplasmic side of the mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
SwissProt AC  --
HGSC (Dpseudoobscura) Contig4832_Contig7452
View Sequence REFERENCE SEQUENCE
Contig Contig4832_Contig7452
Sequence Location 546043..550542
Sequence Lenght 4500bp
Relative Gene location 1006 .. 3470
CDS
CDS Location 1006 .. 3470
Sequence Lenght 735aa
Translation MIRAPLVKALGALGSPTHQIASRAVRTSAIVAQTPAKAPEKIEVFVDDIPVQVLPGTTVL
QAAALVGVEIPRFCYHERLAVAGNCRMCLVEVEKSPKPVAACAMPVMKGWRIKTNSDLTR
KAREGVMEFLLMNHPLDCPICDQGGECDLQDQAMAFGSDRSRFTDINYTGKRAVEDKDIG
PLVKTIMTRCIHCTRCVRFASEIAGVDDLGTTGRGNDMQIGTYVEKLFLSELSGNVIDLC
PVGALTNKPYSFVARPWEIRKVSSIDVLDAVGSNIVVSTRTNEVLRILPRENEDVNEEWL
ADKSRFACDGLKRQRLVAPMVRMPNGELQAVEWEGALIAVAKALKKANGQVAGVAGQLAD
VEAMVALKDLVNRLEGETLVTEQGFIKGSGTDVRANYLLNSTIAGLEEADAVLLVGTNPR
YEAPLVNTRLRKAYVHNESQIASIGPKIDLSYEHDNLGSDPVLIKDVCSGSHAFSKVLEG
AKKPAIIIGADLLEREDGAAIHATIVEYCQKLKKPEWNPFNVLQNNAAQVGAYDVGYQPG
ADRAVKAQPKVLFLLNADAGKVTREQLPKDCFVVYIGSHGDNGASIADAVLPGAAYTEKQ
AIYVNTEGRPQQTLPGVSPPGMAREDWKILRAISEVVGTPLPYDTLDELRARLEDISPHL
TRLGELESAGFNDTGAQAAISKSIGGGAIDVKQKELRDYFMTDAISRSSLTMAKCILAVN
KQKRQDEQAKQSVAI
mRNA
mRNA Location 1006 .. 3470
5'UTR Location  --
3'UTR Location  --
Exon 1006..1188,1257..1588,1654..2683,2746..3240, 3303..3470
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGATACGTGCACCGCTTGTCAAGGCGCTGGGCGCACTGGGCTCACCCACACATCAGATC
GCCAGCCGAGCGGTGCGCACCAGCGCCATCGTGGCCCAGACACCGGCCAAGGCGCCCGAG
AAAATCGAGGTCTTTGTGGATGATATTCCCGTGCAGGTGCTGCCTGGGACCACAGTGCTG
CAG
GCTGCAGCCCTGGTCGGCGTTGAGATTCCGCGCTTCTGCTATCATGAGCGCCTAGCT
GTGGCCGGAAACTGCCGCATGTGCTTGGTGGAGGTGGAGAAGAGTCCCAAGCCGGTGGCC
GCCTGCGCCATGCCCGTCATGAAGGGCTGGCGCATCAAGACCAACTCGGATCTGACGCGC
AAGGCTCGCGAAGGCGTCATGGAGTTCCTGCTGATGAACCATCCTTTGGACTGTCCCATT
TGCGACCAGGGGGGCGAGTGCGATCTTCAGGATCAGGCTATGGCCTTTGGCTCCGATCGA
TCCCGCTTCACGGACATAAACTACACCGGCAAGCG
CGCCGTGGAGGACAAGGATATTGGG
CCGCTGGTGAAGACCATCATGACCCGCTGCATCCACTGCACCAGATGCGTTCGCTTCGCC
TCAGAAATTGCCGGCGTGGACGATTTGGGCACCACCGGACGCGGCAACGACATGCAGATC
GGTACCTACGTGGAGAAGCTCTTCCTCTCAGAGCTCTCCGGGAACGTGATTGACTTGTGC
CCCGTAGGTGCCCTCACCAACAAGCCCTATAGCTTTGTGGCCCGCCCCTGGGAGATCCGC
AAGGTGAGCAGCATCGATGTCCTGGACGCCGTTGGCAGCAACATCGTCGTTAGCACCCGC
ACCAACGAGGTGCTGCGCATCCTGCCCCGCGAGAACGAAGACGTCAACGAGGAGTGGTTA
GCGGACAAGTCCCGCTTCGCTTGCGACGGACTCAAGCGCCAGCGCTTAGTCGCCCCCATG
GTGCGCATGCCCAACGGCGAGCTGCAGGCCGTGGAGTGGGAGGGAGCGCTCATTGCGGTG
GCCAAGGCCCTCAAGAAGGCCAATGGACAAGTGGCCGGCGTTGCGGGACAGCTGGCCGAC
GTTGAGGCCATGGTGGCGCTCAAGGATCTGGTCAATCGCCTGGAGGGCGAGACGCTCGTC
ACCGAGCAGGGGTTCATCAAGGGCTCCGGTACCGATGTGCGAGCCAATTATTTGCTCAAC
AGCACCATTGCCGGCCTGGAGGAGGCCGATGCCGTTCTCTTGGTCGGCACTAATCCCCGC
TACGAGGCTCCCCTGGTCAACACGCGGCTGCGCAAGGCCTATGTCCATAACGAGTCGCAG
ATTGCCTCCATTGGTCCCAAGATCGATCTGTCGTACGAACACGACAACCTCGGTTCCGAT
CCTGTCCTCATCAAGGACGTCTGCTCTGGCTCTCACGCCTTCTCCAAGGTGCTCGAGGGC
GCCAAGAAGCCAGCCATTATCATTGGTGCCGATCTCCTGGAGCGCGAAGATGGTGCCGCC
ATCCATGCCACCATCGTGGAGTATTGCCAGAAGCTCAAGAAGCCA
GAGTGGAACCCCTTC
AACGTCTTGCAGAATAATGCCGCCCAGGTGGGAGCCTACGATGTGGGTTACCAGCCGGGA
GCAGATCGCGCCGTCAAGGCCCAGCCCAAGGTGCTGTTCCTGCTGAATGCCGATGCCGGC
AAGGTGACCCGCGAGCAGCTACCCAAGGACTGCTTTGTGGTGTACATTGGATCGCATGGC
GACAATGGAGCCTCCATTGCCGACGCTGTGCTGCCTGGTGCCGCCTACACGGAGAAGCAG
GCTATCTACGTGAACACGGAGGGCAGACCCCAGCAGACATTGCCGGGCGTGTCGCCGCCG
GGCATGGCCCGCGAGGACTGGAAGATACTGCGTGCCATCTCTGAGGTGGTGGGCACCCCG
CTGCCCTACGACACACTCGACGAGCTGCGCGCTCGCCTTGAAGATATTTCGCCACATCTG
ACGCGCCTCGGAGAGCTGGAGTCAGCTGGCTTCAATGACACCGGTGCCCAGGCTGCCATC
AGCAAATCCATCGGCGGCGGAGCCATCGATGTGAAGCAGAAGGAGCTGCGCGACTACTTC
ATGACCGATGCCATTTCACGCTCCTCCCTCACCATGGCCAAGTGCATATTGGCGGTCAAC
AAGCAAAAGCGGCAGGACGAGCAGGCCAAGCAGAGCGTGGCCATCTAG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
CGTGTCACGCACTCACCTCTATCAGCGTGGCCCAAGACGAGACAGTGGCGCCGTTCGCCA
GGGACGGCTCCCACAGAATCGTGCGTCAGTCTGTCCAGACAGGGTAGATGGTGGCTCCAA
GCGACATTCAGCCAATTGTGGTTATTGCTGTTGTAATTTTTCGCGTGACTCTCATGTCAA
GATTTGATCTTACTTGTGGCGTCGGCGTTGGCGGCAGGCGACTGTCCCGAAGTTGTAGTC
GCATCAATGATGCGCCACATGTGTCCCCGGCACCGGTAGGTTTGCCAAATTAGCCATATT
TTAGTTGAACCTGTTCATTTTGTTTATTCGCGAGCTCGGGGAAAACTATAAACACTAATT
AAGGCTTTATATCACATTTTTTACTACAAACTTCGTTTTCTTTCTTTCTATTTGTGTGTG
TATAAAACAGGTGGCGCCATAGTTGATTCTTATTTGAATTTCAACACAAATACGTTTACA
TGGGAATGGTGATTCGAAGTAAACAAAACTCGAACAGCTGTGACGAACCGCGTTGCCAAC
TAATTGAAAAAAGTTCGGCCGCAAGAAAAACAGATTTAATAAAATGAAATAATGGTATAA
TTTAATATGAGATCCAATCAATATGGACATAATTTAGTCAAAAAATTTCTCTTAAAACCA
GATCTGCTGAGTTTTTGCTATCCGCAGAGGTCAGCTGTCAAACGTGCAGTTGGCAACGCG
GCAGTCACAGTTCGACTGTCAAAAGCGATAAAAAAGTTGTCTCCGCATCGAGAATTCAAA
TAAATATTTTCCAGCATTTCGGTAGGTTTTGCTCGATCTGTTCCGCAGCCACGCAGCTCC
TCGAATTCCCGTGAAGTTTTACATCCCCCGGTACATACAATTATGAGGAAAAACAGTTAC
AGCGGGCACAAATCGATAGTTGACCAATGTTGCCAGGCAGCTTACTTATGTAATTGTTAG
GAAAGAGGATTGCAGTTTTTGTGGTTGCTTCTCGTTGCAGAAAATATGATACGTGCACCG
CTTGTCAAGGCGCTGGGCGCACTGGGCTCACCCACACATCAGATCGCCAGCCGAGCGGTG
CGCACCAGCGCCATCGTGGCCCAGACACCGGCCAAGGCGCCCGAGAAAATCGAGGTCTTT
GTGGATGATATTCCCGTGCAGGTGCTGCCTGGGACCACAGTGCTGCAG
GTGAGTGTGTTG
GCATCGTAATCCGACAGTGATCATCCATCATTTCCATCCATTCCCCGTCTGGGCAGGCTG
CAGCCCTGGTCGGCGTTGAGATTCCGCGCTTCTGCTATCATGAGCGCCTAGCTGTGGCCG
GAAACTGCCGCATGTGCTTGGTGGAGGTGGAGAAGAGTCCCAAGCCGGTGGCCGCCTGCG
CCATGCCCGTCATGAAGGGCTGGCGCATCAAGACCAACTCGGATCTGACGCGCAAGGCTC
GCGAAGGCGTCATGGAGTTCCTGCTGATGAACCATCCTTTGGACTGTCCCATTTGCGACC
AGGGGGGCGAGTGCGATCTTCAGGATCAGGCTATGGCCTTTGGCTCCGATCGATCCCGCT
TCACGGACATAAACTACACCGGCAAGCG
GTAAGAGTTCTGCGCTCCTTTCAAATCCTCCT
GCTGATTGCATCCTTATTTTCTGTCGAGTGCAGCGCCGTGGAGGACAAGGATATTGGGCC
GCTGGTGAAGACCATCATGACCCGCTGCATCCACTGCACCAGATGCGTTCGCTTCGCCTC
AGAAATTGCCGGCGTGGACGATTTGGGCACCACCGGACGCGGCAACGACATGCAGATCGG
TACCTACGTGGAGAAGCTCTTCCTCTCAGAGCTCTCCGGGAACGTGATTGACTTGTGCCC
CGTAGGTGCCCTCACCAACAAGCCCTATAGCTTTGTGGCCCGCCCCTGGGAGATCCGCAA
GGTGAGCAGCATCGATGTCCTGGACGCCGTTGGCAGCAACATCGTCGTTAGCACCCGCAC
CAACGAGGTGCTGCGCATCCTGCCCCGCGAGAACGAAGACGTCAACGAGGAGTGGTTAGC
GGACAAGTCCCGCTTCGCTTGCGACGGACTCAAGCGCCAGCGCTTAGTCGCCCCCATGGT
GCGCATGCCCAACGGCGAGCTGCAGGCCGTGGAGTGGGAGGGAGCGCTCATTGCGGTGGC
CAAGGCCCTCAAGAAGGCCAATGGACAAGTGGCCGGCGTTGCGGGACAGCTGGCCGACGT
TGAGGCCATGGTGGCGCTCAAGGATCTGGTCAATCGCCTGGAGGGCGAGACGCTCGTCAC
CGAGCAGGGGTTCATCAAGGGCTCCGGTACCGATGTGCGAGCCAATTATTTGCTCAACAG
CACCATTGCCGGCCTGGAGGAGGCCGATGCCGTTCTCTTGGTCGGCACTAATCCCCGCTA
CGAGGCTCCCCTGGTCAACACGCGGCTGCGCAAGGCCTATGTCCATAACGAGTCGCAGAT
TGCCTCCATTGGTCCCAAGATCGATCTGTCGTACGAACACGACAACCTCGGTTCCGATCC
TGTCCTCATCAAGGACGTCTGCTCTGGCTCTCACGCCTTCTCCAAGGTGCTCGAGGGCGC
CAAGAAGCCAGCCATTATCATTGGTGCCGATCTCCTGGAGCGCGAAGATGGTGCCGCCAT
CCATGCCACCATCGTGGAGTATTGCCAGAAGCTCAAGAAGCCA
GTGAGTCGCTCTTCATG
CATCTCTCTTGTATTATTACGATTATTGCTTTGCCGCAATTGCAGGAGTGGAACCCCTTC
AACGTCTTGCAGAATAATGCCGCCCAGGTGGGAGCCTACGATGTGGGTTACCAGCCGGGA
GCAGATCGCGCCGTCAAGGCCCAGCCCAAGGTGCTGTTCCTGCTGAATGCCGATGCCGGC
AAGGTGACCCGCGAGCAGCTACCCAAGGACTGCTTTGTGGTGTACATTGGATCGCATGGC
GACAATGGAGCCTCCATTGCCGACGCTGTGCTGCCTGGTGCCGCCTACACGGAGAAGCAG
GCTATCTACGTGAACACGGAGGGCAGACCCCAGCAGACATTGCCGGGCGTGTCGCCGCCG
GGCATGGCCCGCGAGGACTGGAAGATACTGCGTGCCATCTCTGAGGTGGTGGGCACCCCG
CTGCCCTACGACACACTCGACGAGCTGCGCGCTCGCCTTGAAGATATTTCGCCACATCTG
ACGCGCCTCGGAGAGCTGGAGTCAGCTGGCTTCAATGACACCGGTGCCCAGGCTGCCATC
GTGAGTAGACCCTGGGTCTTTATCTATTCTCTGTGCCTTATGCACGACCTTTCCTTTTGC
AGAGCAAATCCATCGGCGGCGGAGCCATCGATGTGAAGCAGAAGGAGCTGCGCGACTACT
TCATGACCGATGCCATTTCACGCTCCTCCCTCACCATGGCCAAGTGCATATTGGCGGTCA
ACAAGCAAAAGCGGCAGGACGAGCAGGCCAAGCAGAGCGTGGCCATCTAG
ACCTCCTACC
CCTGATATAACTACTTATTAATTAATGCTCTATATATTTTTTTTAACTTTGCTTCCGCCC
CCGTCTCCTTAAGAACAGAACAGTCAGCAGGAGGAGTCGCAGCAGGAGTAATCGCCGGCA
TAGAACAGCCTTGGCGGAGCTCTAGGCATTGTGAAATGTCTTTCAAGTTGTTCAAAACGA
AACAAAAAATAAATAATTATACAATACGTGAAAATAGGAAAAACCAAAATAAACAACAAA
TAGACAAATACAAAATAATCTTCGGACGGAGCTTTCCCTGCAGATGGGATTCCGGATACC
CCTTTCCACTCAAAAGAACCCACGAAGGTTACCCCTCATTCTGATGATGCTATGGCCATC
CCGCTCTTAGTCATTTGGAGAAAGCGATTCATTTAAGTTGAACTCGATATATTGGGTGTC
GCTTAAAGAGGAATATTGTTCAGAGGTTCTTGGGTCCTTAAGCTTGAAATACAGATAGAT
ATAATGCCATATCCTGTACAATTTAGTCTCTATAATGTCGAATGTCAGATTATAATTTAA
GCTGAATAATCCTCAAGCTGTAAGGTTTCTTGGAGAGAACTCACCAAATATGCAACGAAA
ATTGCATAGGAATATTTAAAACTCTAAAAACCAACCAGCAAATAAGGAAGGATATAATAA
TAGGCAAAGTAAAAAGTGTCTTAGAACATTATAAGCCATTCGTCTTTCGAAGCACGATAC
ATCATAGCAATAGTTCGAACTAACTTGGGCTTCAAGTTTTTCTCTACAAGCAATCATCCT
TGTCTGTTGAGGATGACCCATTATGGGCCCCTATTTTTGATTGCCACAAGTAATTCCACC
TTTAATCCCCAAATGTCAATTCATTTTTGTCCTGGCTTCACTTATTCCAGAAGGTCTGAA
AGGCTCACCAATAACTGAGTGACCTCCTATAAAATTACTGTCTGAGGAGTCATTGGTCAA
GGGTCAAGGTCCACCTTCATTGATTGGTTTTCAGGTGTGCTCTAGAGCCTATGTCGACAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004