login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG14117
Organism Anopheles gambiae str. PEST
Gene Name agEG14117
Product NADH-ubiquinone oxidoreductase 13 kDa-A subunit (NUMM) (By similarity)
GENE MAP
Chromosome 3R
Celera Gene agCG51366
Citogenetic Map 33B
Gene Map
Comment This record is derived from the following: >gb|AAAB01008984.1 >gb|BX037770 3', mRNA sequence. The following contributed to reference sequence development: bases 1..2880 == AAAB01008984.1 6628621..6631500
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is a component of the iron-sulfur (IP) fragment of the enzyme.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class  --
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000014117
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008984.1
Sequence Location 6628621..6631500
Sequence Lenght 2880bp
Relative Gene location 1044 .. 1820
CDS
CDS Location 1122 .. 1713
Sequence Lenght 125aa
Translation MASRMILSPARRLASVVSTRSITTQVLATQCATIKDEITHTGQFYEANDYRNARFVNATK
VVNPNWAIKLIDELPIVKSEQRVVCCDGGTDPALGHPKVYINLDKPGAHACGYCGQRFEK
IDHHH
mRNA
mRNA Location 1044 .. 1820
5'UTR Location 1044..1121
3'UTR Location 1714..1820
Exon 1044..1250,1389..1568,1645..1820
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CTGCAAGTCGGTGTCGCACGATCGAAATAAAAACAACACAGCTCAGCTCAGCAGCGGAAA
AACAAATCACACGCCGGA
ATGGCCTCACGGATGATTCTTTCGCCCGCCCGGCGACTGGCG
AGCGTGGTCAGCACGCGCTCCATCACCACCCAGGTGCTTGCTACGCAGTGCGCCACCATT
AAGGACGAAATCACACACACGGGACAG
TTCTACGAAGCGAACGACTATCGGAATGCCCGT
TTCGTGAACGCTACCAAGGTGGTCAACCCGAACTGGGCCATTAAGCTGATCGACGAGCTG
CCAATCGTCAAGTCGGAGCAGCGCGTCGTGTGCTGCGACGGTGGAACCGATCCCGCCCTT
GGCCATCCCAAAGTGTACATCAATTTG
GACAAACCCGGTGCCCATGCCTGCGGATACTGT
GGGCAGCGTTTCGAGAAGATCGATCATCATCACTGA
AGCAGCTTGCTTTTTTGCTGTGTG
ATCAAACAAAACAAACACAAATACGCCCGTCATGCTGCTTCGTTGAACCTTTAGTCAAAT
AAACGGAGGATATAAAAACCAAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
AGCGAACTGTTGTTCTGCACTTTTCCACCTTATGTTGGAATGCTCGCACTGTGTATCGTC
ACAAACGCGATCACCACCCCGTCTCGAGTTGATGAAAATATCTCTCGTCTTCCCTGCACC
CCGGCCTGGTCTGCGCTCTAAGATTGCCGAGAGATGGATTTGCAACAAGCTCGAGTTTTC
GACGCAAATTTCCGCGCTCTGCTTTCCAACATTCGTCCCCCCTCCACCCTTCTCCGATCA
GATGAGGCACACGCAGGTAAAGGCGTGTGTACGCATACCAAGAGACTTCAACCAGCAAGG
TTGCTGGCGTGAAGGCAAAGCAGCAATTGCCACAACACCAACAACAACACTAACAACAAC
AGCAGCAGCAGCAACAACATTCCTGCTGTGGGAGTGACCGGTGGGAGGCCACAAAACCAC
CCGGCAGATAGAAAAAGCGGGAACCACTCCATGGGACATCCACAGCTGGTTTTACGTTTT
GCGCTTGCAACGACGATTGGAGATTTCTCCGTGCGAAACGCGAAATGCACGTAAACAAAG
TACGACCCCCAAAGCCTGCGGACCGTCGCAATTTCCTTACCTGCGTATGTGGATTGGGAG
GCAACCGTGGCTGGGCAGTAGCGGACCGTCGTCGATACAGCGGGAACGTTTCTAGCAGCG
TGCTCGGTACACCATTTTTGGTGGTGAAATTAATTTCTTTCACAGATCATTTTGTAAAGA
GCGTTTCTTGCGACACTCTGCAGCACTTGTTTCTGTTTTTCTTCTGGTTCGTTTCGGGGT
CGGTGTTTTTGACAGCTGCTCGGGCAGTTCGATGGCCTGTTCGATTATCCGTGCTTAAAT
GCAATGACGGAATAATGTGTCTCTGCTACGTTCGAAAAATACGAGAATGCTTTGAACTAG
TTTCATGATTTTCTGAACATTTATTTCGTACACTTATTTAATTAATACAACATTGTTGAT
AATTTTTTATTACGCCGCCCGAATAATCGAGATTCACCGCGCAGCTGTCACTGCTGTCAA
ACCCCGATCAGCTGCCAATTTCGCTGCAAGTCGGTGTCGCACGATCGAAATAAAAACAAC
ACAGCTCAGCTCAGCAGCGGAAAAACAAATCACACGCCGGA
ATGGCCTCACGGATGATTC
TTTCGCCCGCCCGGCGACTGGCGAGCGTGGTCAGCACGCGCTCCATCACCACCCAGGTGC
TTGCTACGCAGTGCGCCACCATTAAGGACGAAATCACACACACGGGACAG
GTATGTGTAG
AGAGCCGTCTCCCTCGACTGCCTGCCAAACCAGTGGCACGATTACGCAAGTCCCATCCCA
TGCCTTTCGGAGCTGGCCAGGTTGTTATTTCCGTATGTCCATTTATCGCATTAATGTTTC
TATTTCAGTTCTACGAAGCGAACGACTATCGGAATGCCCGTTTCGTGAACGCTACCAAGG
TGGTCAACCCGAACTGGGCCATTAAGCTGATCGACGAGCTGCCAATCGTCAAGTCGGAGC
AGCGCGTCGTGTGCTGCGACGGTGGAACCGATCCCGCCCTTGGCCATCCCAAAGTGTACA
TCAATTTG
GTAATGATTCTATATTAAAACCCGAGTGGGGGGAGAGGGAAAATAGCAGCCA
CTTTAATACTGTCGCCCTTTACAGGACAAACCCGGTGCCCATGCCTGCGGATACTGTGGG
CAGCGTTTCGAGAAGATCGATCATCATCACTGA
AGCAGCTTGCTTTTTTGCTGTGTGATC
AAACAAAACAAACACAAATACGCCCGTCATGCTGCTTCGTTGAACCTTTAGTCAAATAAA
CGGAGGATATAAAAACCAAA
CTAAATCACTTCCGTTATCGAAACTTTGTCCCTTGACCTT
AATAGTTTTTGTTGCGATTTTGGATGATTATAGATTTTAAAATTGATCTTTTGCCCGTTT
AAACAACTTTCGGATGATTAGCAATAACGTTTGCAAACGGGCAATTTTTCGACCATGCCG
AACAATTAAAGTCTCATTAAAATAATCAGCAAAAATCAAAAACCTGCCCCCGACGGGCTC
GATTTTGTTTGTTTCAGCTAAAATGTACCTCTCTCTCTCTTTCACTCTTTCGCAAACGAC
CGGCTATGCATTTGTCTCGCTCATACACGCTGCTTTGCGAAGGGTCGCTGCAGCGCTTGC
GTTGTCGACGCGCATCATAGGTATACACACACACACACGCACACACACCCCCGTGCAGGT
TTGACAGTTGAATAGGAGATTTTCACTATCAGTCGAGTCGGGCCTTCGAACTTTTCTAGA
ACCTTTCCATCCAAGCGGCAGCAATCGAGTGAAAAAAACGCACACACACGGAAAACAAAC
GACAGCAAACGTTTCCCGTTTCGATACTTTGTTATATAGTTAGTTCACCAAAACTCTATT
CTTCCTTCGCATTATATTTTGGTACCTTTTCGACGGTACGTTGGTTCGGCGACGGCAACG
AGCGGTTTTTCGTTTCGGTTTCATCTTCGCTTCGCGTCCCACCGTCGTGTGGTTGTGAAA
CTCGTTACAGCAGCAGAAACGGAAAATTAGCTTTTCCTCATCCCATCCCCAAACAAAACA
AAACGCTACATTCCACGGTGGGCCATCGGTGCGATACGCAAAACATCAGGTGACGACGGC
AAGCCTGAAAGGTGACCTCCTACGTGACTTTTGGTAAAACACCCGGATCCTTGCATCAGA
CACGCTACCCCTTCTCCGCCGACTGTGTGTGTGTGTATGTGTCGGTGTGTTTGTGTTTGC
TGCTGTGATCATTCGTCCATACAACACAGCCGAGCCCAGCTAATCTTCGCGTAAAATCAA
GCAAAACGGGCCAATCGAGGAGCATCGAGTAGCGATTTTCCGCATCACAACAAACGCGCA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004