login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG15380
Organism Anopheles gambiae str. PEST
Gene Name agEG15380
Product NADH-ubiquinone oxidoreductase 13 kDa-B subunit (NUFM) (By similarity).
GENE MAP
Chromosome 2L
Celera Gene agCG52685
Citogenetic Map 22E
Gene Map
Comment This record is derived from the following: >gb|AAAB01008960.1 >gb|BX009793 5', mRNA sequence >gb|BM611177 5', mRNA sequence. The following contributed to reference sequence development: bases 1..2857 - AAAB01008960.1 3991164..3988308
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is a component of the iron-sulfur (IP) fragment of the enzyme.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class  --
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000015380
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008960.1
Sequence Location 3991164..3988308
Sequence Lenght 2857bp
Relative Gene location 1011 .. 1890
CDS
CDS Location 1139 .. 1726
Sequence Lenght 123aa
Translation MAGVIKKATGLTGLHVAKNPHHTLTALYNKILRAVSKMPQDAAYRRYTEQIVSERAKVVA
TTPNVREIEQKINCGQVEELIVQAENELTLARKMLGWKPWEPLAKQAPASQWAWPPANLP
ELK
mRNA
mRNA Location 1011 .. 1890
5'UTR Location 1011..1041,1117..1138
3'UTR Location 1727..1890
Exon 1011..1041,1117..1159,1295..1456,1538..1890
PolyA Signal 1844..1849
mRNA Sequence

 UTR region

 CDS region
AATATTATTTTCCCAGTCTCGAGCACTCTCGCCACTTACGCAAAGCTTCCGCAATGGCCG
GCGTTATCAAGAAG
GCTACCGGATTGACCGGATTGCACGTGGCCAAGAATCCGCACCACA
CGCTAACGGCGCTGTACAACAAGATCCTGCGTGCCGTCTCGAAGATGCCCCAGGATGCGG
CCTACCGACGCTACACCGAGCAGATCGTATCCGAGCGTGCCAAGGTGGTCGCCACG
ACTC
CGAATGTGCGTGAAATCGAGCAAAAGATCAACTGTGGCCAGGTGGAGGAGCTGATCGTGC
AGGCAGAAAACGAGCTGACGCTCGCGCGCAAGATGCTCGGCTGGAAACCCTGGGAACCGC
TGGCCAAGCAGGCACCGGCCAGCCAGTGGGCCTGGCCACCGGCGAACCTGCCCGAGCTGA
AGTAA
ATCTCGCCCCGCGGGTGTTCTTTTGTCCCTTTTCACACCACACCAATATTCTTCT
CACAGAGACACACACTTGTAGGCAATGCAAAATCGGTTGTTTAGGGTCGCGTATGGCGTG
TAAATAAAAAAAAACAACAACAGGCAACAACACGTGCGGCCATAAGGAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GCGATGCACCACCACTACCACCACTAGCAGCAGCAGCAGCAGCAGTATGCACTGGTGTAC
GAGAACTGTTTCCTTCAGGAAGGGTTGTTGTCCCTTCGGAGCGACAGAATTTGCTGTATC
GCGAAACAGGCTGGCTGGGTAACACTTTCTACAATTTCATCACAGTAACCGATCGTTGGC
AGCATTTGAAGCAATAGAGCGACCGTGTATTTGTGTGTGTGTGTACCACTCCGTTACCAC
ACTGCACGGGTGAAAAAAAGGCAGAGAGTGTGTGTTGTTTTGTTGGTGTGTGGGGGGGTG
GTTTTTCACTTTTTCGCACACCACCCCACCCTGTCGATTTCCGTTGTGGGTTTTATTTAC
GTGTTTCGACGAATGCGACGGGCTGGTTGTATTTGATATCGTTCGCTTTCTTCACACACA
CCCACCCCCGATTTCACCCTCTGCTATTTGATTCGCTGCTTCCGTGCAATGAATGTGCAG
GAAGCGAATTGAACGCGCAGCAAATTGTTACGAACCCCTTGGGTGGGTATACAGCACACA
CACACAAACACCAGTGTTTGTTGTTTTTTCTCTTCTTCGTTTCCCTTCTTTGCAGCTTTC
GACCTTCTTCACCTACCCTACCCAGAAGCGCTAATCTTTGTTGTTGTTTTTCTTCCCCGT
TTTCTTTGTGCCACACCACTTCTTCGTTGCTGTTGGTACTGCACTCGAGTCGGAAAGGCG
AATGAAGCGATTTGCGTAATTTTGGTTGAAATAAAGCTTTTACCGAACTGCTTAGCTGTG
ATGTATAAAATTACGAGAGAGACACACAAACACAACCCATCGCCCCACTGCAAAACGCGA
GACTGTGATTATTTATCTTTTTTTTTGCACAAAAAAACATCACGTCATTTTACTACCTTT
TTTTTTCTTCCACCACAAACGTCAAACAACGAAGGTCGTGCGACGTGTAGTCGCCGCTTC
AGCTGCGTAGAGCTGTCAACAGCTGACGTTTGTCGCGTGAGGAAAAAGAAAATATTATTT
TCCCAGTCTCGAGCACTCTCG
GTACGATTGCTGCGGGGTTTTTATTCACAAAATTCGCCT
CCACACTGTTATTAACGTTTGTTTTTCCACTTTTAGCCACTTACGCAAAGCTTCCGCAAT
GGCCGGCGTTATCAAGAAG
GTAGGTAAAGGTGCATAAATAAGCCTTGGGCAGTAGAAATG
GGTATGCCCCCACGAAAGAGGCTGCACTGATTATGTCACAAATAAACCGGCACGGAATGG
AAAGGACCTCACACCTATTCCTTCTCCCCTGCAGGCTACCGGATTGACCGGATTGCACGT
GGCCAAGAATCCGCACCACACGCTAACGGCGCTGTACAACAAGATCCTGCGTGCCGTCTC
GAAGATGCCCCAGGATGCGGCCTACCGACGCTACACCGAGCAGATCGTATCCGAGCGTGC
CAAGGTGGTCGCCACG
GTAAGCAACCCGAGCGATGTGGACCGACGAACCGCTGTTATGTT
ACAATTCTCATTTATTTTTGTGCCGTTGTTCACCCAGACTCCGAATGTGCGTGAAATCGA
GCAAAAGATCAACTGTGGCCAGGTGGAGGAGCTGATCGTGCAGGCAGAAAACGAGCTGAC
GCTCGCGCGCAAGATGCTCGGCTGGAAACCCTGGGAACCGCTGGCCAAGCAGGCACCGGC
CAGCCAGTGGGCCTGGCCACCGGCGAACCTGCCCGAGCTGAAGTAA
ATCTCGCCCCGCGG
GTGTTCTTTTGTCCCTTTTCACACCACACCAATATTCTTCTCACAGAGACACACACTTGT
AGGCAATGCAAAATCGGTTGTTTAGGGTCGCGTATGGCGTGTAAATAAAAAAAAACAACA
ACAGGCAACAACACGTGCGGCCATAAGGAA
CACGGTGATATCGTGTGTGAGAGTTTAATA
CTCTTAGTAACTACTAGGTACAACATCATGATGACCGGTTTGTTTTCCGTTCCCCGGATG
ACTTCTGGTGACGTAGCGTCATAGCCGAAAGAGGGTAAACCTAGCGAGTAAAAACTACCT
TCAGCTTCAGCCGGTAATCTCGTCCTGCAACCCGAGAGTGGCGAAAGGACGACACGTGTC
AGTAACCGTGCGAGAAAGTCAACATTCCGCTAATGCGCGCTTTACCATCGCCCGAAAGGC
CGCCGAAATGCTGCGTGTAACTAGCCGAACCGTCCAGCTTGGTGTTGCCGCTCTGGCTTT
TCCACAGGCTGGCGATCGCTTCCGCGTTCACGTCCGTCCCGTACCCATCCTCGTGCGTGG
CGCCAAAGTTGAGCGAAAACTGTCGCTTGTATCGCTGCAGTCTCTGAGGGGAGGGGAGCA
AAATCGGTCTCGGGGTTAGTGAAGAGAACCCTTCATAGTACAGCAAAAGGGTCACCGCCT
TACCGCTATCAGCTGACTGTCACCTTCGCGCAGGGGTTTTGCGTGAGTGGCGGAGTGCGC
CAGCATCAACACCAAACCGTACAGCAGTAGTAAACTAAAATTGAGCTTCATGTTTTACAA
GAAGTAGGTTTTTTTTTGGGGGGCGATCTAAATGCAACTGTCAGGGCAATTACTACTGGA
ACACAACCACGACCGCCGTTCGATCGTTCACGATTGACGCGACTGCGTGTGGGAATGTTT
GTTGTACATTCTTTTACTGATAACGACGATCCTCATCATCGATCGGGGGAACAAGTTCGT
CATACACACACGTACACACAGCATCATGCTTTTGTTGAAAACAGCTCAAAACGAGAGTTC
TGTTTGCGAAAGAATTGCAAACGTATCAATCATTTAAAAACCATCGGACAGTGTTGATCG
CTGGGAACGATCGTTGATCGACTCAACAGAATGTGTG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004