login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG8680
Organism Drosophila melanogaster
Gene Name CG8680
Product NADH-ubiquinone oxidoreductase 13 kDa-A subunit (NUMM) (By similarity).
GENE MAP
Chromosome 2L
Citogenetic Map 25C5-25C6
Gene Map
Comment This record is derived from the following: AE003608 >AT29395.5prime BF492452. The following contributed to reference sequence development: bases 1..2700 == AE003608 157087..159786
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is a component of the iron-sulfur (IP) fragment of the enzyme.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class  --
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
SwissProt AC  --
FLYBASE FBgn0031684
View Sequence REFERENCE SEQUENCE
Scaffold AE003608
Sequence Location 157087..159786
Sequence Lenght 2700bp
Relative Gene location 997 .. 1713
CDS
CDS Location 1070 .. 1609
Sequence Lenght 126aa
Translation MASKQLVNNLSKLGLPRQNWMSPLASVRHSSCRGDIEKVTHTGQVFDKEDYRNARFVNAK
RYVNENWGIKLIEEVPPKECTERVVFCDGGDGPLGHPKVYINLDKPGNHICGYCGLRFVK
KDDHHH
mRNA
mRNA Location 997 .. 1713
5'UTR Location 997..1069
3'UTR Location 1610..1713
Exon 997..1201,1297..1474,1538..1713
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ACGCTGTCAGCCTGACAGTTACAGGGTGTTTCGTGTCAGAATACATTTTGCGTACAAATT
TTTGTGGTAAAAA
ATGGCCAGCAAGCAATTGGTAAACAATTTGTCCAAACTCGGCCTTCC
GCGACAGAATTGGATGTCCCCACTGGCCAGCGTTCGCCACTCCAGCTGCCGCGGCGACAT
CGAGAAGGTTACACACACCGGACAA
GGTGTTCGATAAGGAGGACTACCGCAATGCCCGGT
TCGTGAACGCCAAGCGGTATGTGAACGAGAACTGGGGCATCAAGCTCATCGAGGAGGTGC
CACCCAAGGAGTGCACCGAACGAGTTGTCTTCTGCGACGGCGGCGATGGTCCTTTGGGTC
ATCCCAAAGTGTACATCAACCTG
GACAAACCCGGAAATCACATCTGCGGCTACTGCGGCC
TGCGCTTCGTCAAGAAAGATGACCATCATCATTGA
GGAAACCATAGTGGCCAATAGATTT
TAGCTAAAACACCTTTCTATCCTGTTGCGCTAGCTTGAACTAAACTAAACTAAATAAAAT
TAGAACACCAAAAAGCTAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TCCATTTCTCTCGCACCGGAAAACGTGGAAAAACACGTTTTTTTTCTCCAACGAGCACTT
CACTGCCGATTATGTAATCCGTGGAAATTTGTGTATTTTTCGAAGCTTTTTCAATGGGAT
GTACTAATGTACACAGGCACAGCAATTAATTTGTAACATTACACACCGTAAATTCGCTTT
GATTTTACGCCAGTATTCTTAGCGCGAACAATTCCAATTTCAATTTCTATATATGCGTAT
ATATAGAGGCGTGTATATATGCATGGATGGCCGGAAAGAAGACTTTTCAATGAAAAACTT
TAGATGTTGTAGAGGAAGAACCGAGAACAACACTCGACGAGCACGAAACACTAACTGAAT
TGCCTCCCCAAGCGCCAGGAGGCACATCCCCGATCTTTGGGGAAATTTCGAAAATTTTCG
AAATGCTGGCTGCTTCGGGAAATGCGAACGAACATTTGGCTCTCGGCATTTCTTGCCGGC
TTTTCTTTTTGTGAATCGTGCCGCAAGGGAAAACATTTCTCTTTCTTCGTCTTTTGTTTA
CATCCCTTTTTTCTAAACAACAACGATCAAGTAGCGCAAAAACTTTGGCATTCTAAAGAG
AATAGGTAAAAAAAAGAAATTTATGCCTCCTAAAAAACTTAATCTAAAAAAGTAAGTGCA
CTATTTGTCTGTACGCTAGCTTTTTTTGAAATCAAGTTAATTGTTAAAATGGAGCCACTA
CTTTGACAGAATACTTGTACAATTTATAACATCTTCTGAATTACAAAAAACCGGTTAAGA
GAGTAACAAAACTCAAACAACCTATATTAAATATTATTTCACTGAATTAATAAATAGTAT
TCCCTAAAATTTTATTAATTTATTCTTAATTTATTATAGACCAATTGTTTTGAAGAAACT
GTCAAATAAGTAAGCTATTTTTAAATAACCAGTGTGACCGCTGATCGGTAAATGTAAACT
AACATCTGCGCCGTTAGCTTGCTGTTAGGCCAGCTGACGCTGTCAGCCTGACAGTTACAG
GGTGTTTCGTGTCAGAATACATTTTGCGTACAAATTTTTGTGGTAAAAA
ATGGCCAGCAA
GCAATTGGTAAACAATTTGTCCAAACTCGGCCTTCCGCGACAGAATTGGATGTCCCCACT
GGCCAGCGTTCGCCACTCCAGCTGCCGCGGCGACATCGAGAAGGTTACACACACCGGACA
A
GTAAGAGAAATTGGAACTGTTGACCCGATCATCCTGCGATTACGCAAACATTTTGTGGA
ATATGTACGAAAATATCTAAATTAATACATATTTCAGGTGTTCGATAAGGAGGACTACCG
CAATGCCCGGTTCGTGAACGCCAAGCGGTATGTGAACGAGAACTGGGGCATCAAGCTCAT
CGAGGAGGTGCCACCCAAGGAGTGCACCGAACGAGTTGTCTTCTGCGACGGCGGCGATGG
TCCTTTGGGTCATCCCAAAGTGTACATCAACCTG
GTGAGGTCTTGAGCGGCTATTAGAGG
CATACACTTGACTAATTGGATCATGTTTTGTTTGCAGGACAAACCCGGAAATCACATCTG
CGGCTACTGCGGCCTGCGCTTCGTCAAGAAAGATGACCATCATCATTGA
GGAAACCATAG
TGGCCAATAGATTTTAGCTAAAACACCTTTCTATCCTGTTGCGCTAGCTTGAACTAAACT
AAACTAAATAAAATTAGAACACCAAAAAGCTAA
TCATATGAAGGAGTACCATAATTATTA
CTCTATCCCAATGGATAAATCAGCTAAAAGCAATCTTTTCCCGAAATGAAAGTCAACTCT
TTTTTTATTGCACAACACTTTATTTGCATGTGTCTTGAATGATTACTAATGCGTGCATGC
ATTGTGTCCTCTTAGAAAGTTAAATCTGATCAAAATCAACTTAAGCTTTAAAGTTTAGTA
AAACTAATAAACAAAAACCGAATTGTAATTCAAAATACTGTGAGTTGAACTCGGGACTGC
TTGGGCAGAAGCCAGATCAATTCACCGCGCGGGTGTTTTGTGTTTTAAGTGTATAAAATG
TTGAGTAAAACTAACAAAGTTAACGCAATCGTAAATAGTAAATAGTATATAAACTTGCTT
TGTTTGTTGCCTGGTAAAGCGGTAATGTATTGTATAGTGGTTTCAATTTATCATTTTTCG
CTGTTAAATCACTACGGGCACTTTAGATGCTGACGATCGCAGCATTGAGACACAGATAGT
ACCACGAAAAAACAATACAATAATACAATAACTGCCGCCGCTTAGGCGATTGTTTGTTGG
TTGCTTTTTGCTTTGGATGCCAGCCAGCGCTCTGCGGGAAGAATTGGAGCGGACGACTCG
AAAGTCTACCCACCATTCCTGCTCCTGTGTGGCCTGCTCCTGCTGCTCACAAAACCGAAA
TGAATCATACGTTCACACCGCTCAACACGAGCCATCTCCGATACCAATTCCATCTCCAAC
CGTCGGGAGTTCGAGCTTGGCCTGCAGAGTGCCCTGGATCTGGGAACTGAAAGTGCGGCG
CCGCCGGGTGGTGCGCCAGTCTCACATAATATATATGCCCAGCGGATCAATGATCGCTGT
TCAATAAAATCATGGTCAATAATCATCGTCGTCATCATCTGTTGTCTCAAGTGCGTTTCA
TCTAAAACACCAAACACTAAGGAGAATGTAAACTAAAATGTAGTAGGTTCTAATTTGGAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004