login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG6485
Organism Drosophila pseudoobscura
Gene Name Dpse\CG6485
Product NADH-ubiquinone oxidoreductase 24 kDa subunit (NUHM) (By similarity)
GENE MAP
Chromosome pseudoXR-mel3L
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig3914_Contig1507 The following contributed to reference sequence development: bases 1..1750 - Contig3914_Contig1507 247001..249750
PRODUCT
Function Transfer of elecrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Component of the flavoprotein-sulfur (FP) fragment of the enzyme.
Subcellular Location Mitochondrial matrix and cytoplasmic side of the mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
GO:0007399
Biological process: neurogenesis
SwissProt AC  --
HGSC (Dpseudoobscura) Contig3914_Contig1507
View Sequence REFERENCE SEQUENCE
Contig Contig3914_Contig1507
Sequence Location 247001..249750
Sequence Lenght 2750bp
Relative Gene location 1032 .. 1769
CDS
CDS Location 1032 .. 1769
Sequence Lenght 245aa
Translation MFGLLEVGLLALPRLCTLGRSLHITSMRRRSKLDACNMYDKMKFEFTKENKARVESLLTW
YPEAERQGALLPLLDIAQRQHGWLPISAVVAVAEVLKIDPMQAYETAKYYTMFHMKPRGM
YVVAVCTSTPCFLRGSDDLLKACSKMLRLEPGETSKDMQFSLKVDCCLGACVNGPVVTIN
DDLYEDLTEVSLESILSDLKCGKVPPAGPYSGRCSSEPKDGATTLLIDPPPAGYKMQDLD
DSGEK
mRNA
mRNA Location 1032 .. 1769
5'UTR Location  --
3'UTR Location  --
Exon 1032..1769
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGTTTGGTCTTCTGGAAGTAGGACTCCTGGCCTTGCCACGTCTTTGCACACTGGGACGT
TCCCTTCACATCACTTCGATGCGCCGACGGTCCAAACTGGATGCATGTAACATGTACGAC
AAGATGAAGTTTGAGTTCACCAAAGAGAACAAGGCCCGTGTCGAGTCCCTGCTCACTTGG
TACCCAGAAGCGGAGCGTCAAGGCGCACTATTGCCACTCCTCGACATCGCTCAGCGCCAG
CATGGCTGGCTGCCGATCTCGGCCGTGGTGGCAGTCGCTGAGGTGCTGAAGATCGATCCG
ATGCAGGCCTACGAAACGGCCAAGTACTACACAATGTTCCACATGAAGCCGCGCGGCATG
TACGTAGTGGCCGTCTGCACTTCCACGCCGTGCTTTCTACGCGGCAGCGACGACCTGTTG
AAGGCGTGCTCGAAGATGCTCCGCCTGGAGCCGGGCGAGACCAGCAAGGACATGCAGTTC
AGCCTGAAAGTCGACTGTTGTTTGGGGGCCTGTGTGAACGGGCCCGTAGTTACCATCAAC
GACGACCTGTACGAGGATCTCACCGAGGTAAGCCTCGAGTCCATTTTGAGTGATCTGAAA
TGTGGCAAGGTACCGCCTGCGGGCCCCTACTCTGGACGCTGCTCCAGCGAACCGAAAGAC
GGAGCGACCACTCTGCTAATTGACCCACCTCCAGCCGGCTACAAGATGCAGGATTTGGAC
GATTCTGGCGAGAAATGA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
ATATACATACCTATGTACTATGCTTATAAGCAGTTGGCTCTTGCTGAGAAAATGTGGACC
AAAATCCTCTTTACAATAATTCTTGTAACAAAATGATTTCGTATACCATCCTTGTAATCA
TTGATTCTGTAATCACAGAGAATATATAATATGTCTTTCCATAATCTCAATTATAATGCA
TAAATATCTCTTTCTAAGTGTTTCCAAAGCTAGTACGAGTACATACCCCCGATACCATCT
TGTTCCATCAAATGATATTCTGTCTATCTTCAATATTCAATTAATTACGCAAAAAATGTT
GAGTAGCTCTTCAATGGAGTACAAGAATACCTCCTGCCTTTCCCTTGATGACATTATACC
GTACAACATTTGGAACTCTCGCGCACACATACATTTTTGGTGGGACAACATGTGCTTTGG
GTGCTTTTGCCTACTTACAACATTTACGGTATGCCATCTGCAGTCAATGCCAGTTTGAAT
AGCCATTACTCTAATTGTTTATTATGGATTTCGATCATAAATGAGCATTATGTTGCTGGC
ATAATGTCTGCATTTTACGATCTAATCTTTTAGGGAGTGTAGACACACACACCCCATGTT
AACCCAGTAATAACCCATAATAAAAAAGCTGTAAATGAACCCAGGTGGCAGGTGTTAATA
AGCCAGAAGCCTCTATCAATGGAATTGGGTGTGTGAAGCCCGCCCCACACTTCCACTCTT
TGACAATTAAGCGGGAGCATGGCATGCAATTTGAGTCATCTGTGGGGTGGATTGACAAAA
AAGAGGAACACCGATTGGATGTTGTCACCTCGCTGTTGGCATAGAAGCGACTATCTAAAT
TTGATTGCAATTTGCTCTGTGCCAGCATCAAGGATTTCTAATAAACTCGAACTAGTGCGA
AAGGAGTCAGAGAGGTGAACGTCAAAGCACATAAGAATTCAATATCAAGCAATTCACACA
AAAGAAACTAGTATTCCCAGTCAACAATTTGAGCTGAAATTCCACAAAAATATATATACA
GTTTTTCCGCAATGTTTGGTCTTCTGGAAGTAGGACTCCTGGCCTTGCCACGTCTTTGCA
CACTGGGACGTTCCCTTCACATCACTTCGATGCGCCGACGGTCCAAACTGGATGCATGTA
ACATGTACGACAAGATGAAGTTTGAGTTCACCAAAGAGAACAAGGCCCGTGTCGAGTCCC
TGCTCACTTGGTACCCAGAAGCGGAGCGTCAAGGCGCACTATTGCCACTCCTCGACATCG
CTCAGCGCCAGCATGGCTGGCTGCCGATCTCGGCCGTGGTGGCAGTCGCTGAGGTGCTGA
AGATCGATCCGATGCAGGCCTACGAAACGGCCAAGTACTACACAATGTTCCACATGAAGC
CGCGCGGCATGTACGTAGTGGCCGTCTGCACTTCCACGCCGTGCTTTCTACGCGGCAGCG
ACGACCTGTTGAAGGCGTGCTCGAAGATGCTCCGCCTGGAGCCGGGCGAGACCAGCAAGG
ACATGCAGTTCAGCCTGAAAGTCGACTGTTGTTTGGGGGCCTGTGTGAACGGGCCCGTAG
TTACCATCAACGACGACCTGTACGAGGATCTCACCGAGGTAAGCCTCGAGTCCATTTTGA
GTGATCTGAAATGTGGCAAGGTACCGCCTGCGGGCCCCTACTCTGGACGCTGCTCCAGCG
AACCGAAAGACGGAGCGACCACTCTGCTAATTGACCCACCTCCAGCCGGCTACAAGATGC
AGGATTTGGACGATTCTGGCGAGAAATGA
ATATGTCCTTTATAGGCTTTACTCTTGTTTT
CCATCGTTTATTAAGTTTTAAAGCAATAAATTCCGATTGCCATTGGCAACAGCAAAGAAA
TTCGAAAGAGTGCTGCCAACAGCTGTTGTTTTGCTAAGCTCCTTCTCATCCGCATTCACA
TTCACAATCACATTCGCATTCGGATTCGCATTGTCCTCGTTTGTGTCCGTGTCTGTGTCC
TGGGTCCGGGTCCGGGTCCGAGTCCGTGTCTGCTGCCATTGCAGTTTATCCCTGGCCAAA
GGACATGCCTTGGATTTCTGCAGCGCTGGCACAATAAACAGACAGCAGCAATGACAAAAC
AAGAAGGAGACACTCCTCACCCCAGAGTCGAAGATATCATACCCTACGCAGCAGGAAGAT
GGGTAATAATGAGATATACTTGAAGGGTTCTCCTTTATGAATTGACTTTCCAATCTATTC
GTTTTAATTTTAAGGTTTTTTCAGCATAAATGGCTAGAATCAATTATTGGCTAAATTTAG
CTGTTGCTTTATTTGAACTTAATGTTGAGATGTACAAACTGCAAAAATAGGATGAGATAA
TGGCTCTTAAAATTGTTGGTACCAGTACGGTTAACCTTCTGTCAAGGGTATAGCCAGTAC
TGTATCCCTACGTATTCCTATGTCTAGGGGGCCCGGCCCGGCCCATGTCCTGTCAGGCAG
TGCAGCAAGTAATCAGCTTTTGTCTTGTATCTTCCCCAGCCCTTGCGTGATGCGGTTTGA
CCTCGGCCCTAGGGCATGCCCCGCCAGCAGCATTCTAATAAAATGTTCGGCAGCAACGAG
CAGGAAACAACGAGCAACAGCAACAACAGCACAGGCAGCAGCGGCAACTTCAAAAGCTGG
CAGCGTTGGCAACAACCCCGATATTGTTTTGGCCAAAATAGTTTTAATTGTTGCGCGCTC
CCTTAAAGGCAGGCAGGGCCCTGCTTCGCGTCGAATCCCTATCCCTAGGC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004