login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG6485
Organism Drosophila melanogaster
Gene Name CG6485
Product NADH-ubiquinone oxidoreductase 24 kDa subunit (NUHM) (By similarity)
GENE MAP
Chromosome 3L
Citogenetic Map 74A4
Gene Map
Comment This record is derived from the following: AE003524 gb|AY089390|AY089390 AT21479 full insert cDNA. Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Transfer of elecrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Component of the flavoprotein-sulfur (FP) fragment of the enzyme.
Subcellular Location Mitochondrial matrix and cytoplasmic side of the mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
GO:0007399
Biological process: neurogenesis
SwissProt AC  --
FLYBASE FBgn0036706
View Sequence REFERENCE SEQUENCE
Scaffold AE003524
Sequence Location  --
Sequence Lenght 2760bp
Relative Gene location 960 .. 1787
CDS
CDS Location 1027 .. 1743
Sequence Lenght 238aa
Translation MLRLLQPIRRIHLAPVLRLGAPVNATEIRKALKFEFSKDNQRRVKALLAWYPQAEWKGAL
LPLLDIAQRQQGWLSISAVQAVAETIKIDPMEAFEAAQFYTMFFMKPRGKYVVSVCTSTP
CKLRGGDEIFEACKKTLNLEHGQTTPDMQFTLKEDYCMGACVNAPVLAVNDDMYEDLDEK
SLANILADLRNDKLPPAGPRNGRFASEPKGGLTTLKIQPPPPGFMMQKLPDPKTKKCQ
mRNA
mRNA Location 960 .. 1787
5'UTR Location 960..1026
3'UTR Location 1744..1787
Exon 960..1787
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATTCAACGTTAGGCGAATCTCATATACACAGGGTTAAGTACGTACATATACATATATTTA
TACCGCT
ATGCTGCGCTTGCTTCAGCCCATCCGCCGCATCCACCTGGCACCCGTTCTCCG
TTTGGGAGCACCGGTGAATGCCACTGAAATACGCAAAGCACTGAAGTTCGAGTTCTCCAA
GGATAACCAGCGGAGGGTGAAGGCCCTGCTCGCCTGGTATCCGCAGGCGGAGTGGAAGGG
AGCACTCCTGCCACTACTGGATATTGCCCAGCGGCAGCAGGGATGGCTTTCGATCAGTGC
CGTTCAGGCCGTGGCCGAGACCATCAAGATAGATCCAATGGAGGCCTTCGAGGCGGCGCA
GTTCTACACCATGTTCTTCATGAAGCCGCGCGGGAAATATGTGGTCAGTGTGTGCACCTC
GACGCCCTGCAAATTGCGTGGGGGCGACGAAATCTTTGAGGCGTGCAAGAAAACGCTCAA
TCTGGAGCACGGTCAGACCACGCCGGACATGCAGTTCACGCTCAAGGAGGATTACTGCAT
GGGCGCCTGTGTGAATGCCCCCGTTCTGGCGGTCAACGATGACATGTACGAGGACCTGGA
CGAGAAGAGTCTGGCCAACATCCTGGCGGATCTGCGCAATGACAAGTTGCCGCCCGCTGG
TCCGCGCAACGGTAGGTTTGCCAGTGAGCCCAAGGGTGGACTTACCACCCTAAAGATCCA
GCCACCGCCGCCCGGCTTCATGATGCAGAAACTACCAGATCCGAAGACCAAGAAGTGTCA
GTAG
CCATTGATTAAGTCTTAAAGCAATAAATTCCGCCTGCCTTCGGG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TTAGCGTTATGCTATCTGCAGTCGATGCCACTTTGAATAGCCATTATCCTAATTGTTTAT
TATGGATTTTGATCGGATACTGTGCGAGCATAATGTCTGCGTTTTACGATCTAATCTTTT
GGGCCCACACAGATGCACATTAATAAAGCGTAATAAAAACGCCATAAATGAGCCGGGGGA
CAGGTGTTGATAACCGAGTTCTGGTATCATTACTATTGTTCGTAAGTGAAGTGTGAAATG
CTCGGGGAAATGGAGTTGAACCCGTGGAGTTTGACGCAACCCCTGAACCTGGTGAATTTG
ACCTGCAGCTCTGATATTGACAATTAAGAGCGGCATGCAATTTGAACAATTTGCGGCAGA
GAGACTTGATTGGCATGCTGTGACCTCGCTTTGCGGATTCACCACCTCCACGTTGTCATG
ACGAGCAGCTGGCCAACTCAATTTGATTGCAATTTGGCCACAACACACTGATTTGCAGCG
TAGTTAAATAGAGAAATATTGCATAAAAAAGTGAGAAGGATATTATGAGCTGAATTTGTG
GGCTGAAAGCAATAGCTTAAAGCATTCATTTAAGCAAATCTTTTCTCGAAGCTATGAAAC
GTACTCTTTTTTGACTTTCCACTGTGAACCATTTATCGTTTAAATTCTTCTGATATAAAT
GTCTGTATTATTAAATTTACTATTCGTAATAGGAATTAGGTTTAATATATTTGTATTATT
TATCTCTTAAATTATACACTTATTTGTTTTCCATTTCTCGTTTACCATTTAAATATAATT
AATTCGATGTTGTGCGACATTAAACATATTTGTTTTCATTATGCAAGCATTCAATTGACA
TCGATATTATTTATTTGATACTCGATATATTGCGAATATTCCCACTCGATGGCGGCTTTG
ATAATATATGTGCTTTATGTATTCCGAGAGATGGATGTCAATGCGATAGGAATTTCAATA
TTCAACGTTAGGCGAATCTCATATACACAGGGTTAAGTACGTACATATACATATATTTAT
ACCGCT
ATGCTGCGCTTGCTTCAGCCCATCCGCCGCATCCACCTGGCACCCGTTCTCCGT
TTGGGAGCACCGGTGAATGCCACTGAAATACGCAAAGCACTGAAGTTCGAGTTCTCCAAG
GATAACCAGCGGAGGGTGAAGGCCCTGCTCGCCTGGTATCCGCAGGCGGAGTGGAAGGGA
GCACTCCTGCCACTACTGGATATTGCCCAGCGGCAGCAGGGATGGCTTTCGATCAGTGCC
GTTCAGGCCGTGGCCGAGACCATCAAGATAGATCCAATGGAGGCCTTCGAGGCGGCGCAG
TTCTACACCATGTTCTTCATGAAGCCGCGCGGGAAATATGTGGTCAGTGTGTGCACCTCG
ACGCCCTGCAAATTGCGTGGGGGCGACGAAATCTTTGAGGCGTGCAAGAAAACGCTCAAT
CTGGAGCACGGTCAGACCACGCCGGACATGCAGTTCACGCTCAAGGAGGATTACTGCATG
GGCGCCTGTGTGAATGCCCCCGTTCTGGCGGTCAACGATGACATGTACGAGGACCTGGAC
GAGAAGAGTCTGGCCAACATCCTGGCGGATCTGCGCAATGACAAGTTGCCGCCCGCTGGT
CCGCGCAACGGTAGGTTTGCCAGTGAGCCCAAGGGTGGACTTACCACCCTAAAGATCCAG
CCACCGCCGCCCGGCTTCATGATGCAGAAACTACCAGATCCGAAGACCAAGAAGTGTCAG
TAG
CCATTGATTAAGTCTTAAAGCAATAAATTCCGCCTGCCTTCGGGAATGCAATTCGCC
CAGGCATCTGGGGTCGGGGGTCGCGGGCCAGCAGCTGTTGTTTTGCTAAGCTCCTGCCCA
GTCGCATTCTCGCGTCCTGCGCTCGCAGTCGCCTCCTTTCGCTGCCGCTGCACTTTATCC
TTGGCCAAAGGACATGCTTTCGAGTTTTGCAGCGCTGGCACAATAAACAGACAGCAGCAA
TGACAAAACAACGGAACAACACAAGATATGGGGTATGGTAGATGGAGTTGGCAACGAAGT
CACATGCCCTTTCCCACTTTAATAGTCATTGGTTGAAATCACATTATCAGTATAGTATTT
TTTATTATTTATTTATTTGTGTACTTGATCTAAAGGTATTTAATCGGATTTTTTTGAAGC
AAGAGACTTCCTTTTATGCGAATAACCGTGCTGTTATAGGGCATAGTCAAGCCCCATGTC
CTGTCAGCCATTGCAGCAAGCAATCAGCTTCGGTCTTGTCCTTTCGTCTTCGCCCCTAAC
CCCTCGCCCAACACCCGCTGGCCACTCCCACTTGCCACTCCCGGTGGCCAGCGCTCCTTG
ACACCGACCCCCCTTGCGGTTTGACCCGGACCCGGCCTGCATTCTAATAAAATGTTGCCA
ACAGCGAACAACCCGCGCAACGAGCAGCAAACAACTGGCAACTGTGAAAGCTGGCGGCGA
TGGCAACAACCCGATATTGTTTTGGCCAAAATAGTTTTAATTGTTGCCAGCTCCGCAGCA
GCTTACCATCGCTGGAGGAGCAGGTCCTTTGGCACTCGCGCAGTCAAATTACAATGGATA
TTTTTCAGTTTTCATAAATCTGTTTGTCGCCCCACTTCAATGGCCATCAACAAGCGGTTG
CTAGCCGGAATGCCAGGCTAGCTCACCCACATTTTTCCCATTTTCCCCAGCACATTTCCC
TAAGCCCCCGCCACCATTCCCCAATCCCCACACCGCCTGTCCCTGCGCATGGTGTTGAAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004