login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG16953
Organism Anopheles gambiae str. PEST
Gene Name agEG16953
Product NADH-ubiquinone oxidoreductase 24 kDa subunit (NUHM) (By similarity)
GENE MAP
Chromosome 2R
Celera Gene agCG45791
Citogenetic Map 10D-11A
Gene Map
Comment This record is derived from the following: gb|AAAB01008799.1 gb|BM651691.1 5', mRNA sequence gb|AJ282626.1 3', mRNA sequence gb|AJ284297.1 3', mRNA sequence The following contributed to reference sequence development: bases 1..3145 - AAAB01008799.1 2171452..2174596
PRODUCT
Function Transfer of elecrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Component of the flavoprotein-sulfur (FP) fragment of the enzyme.
Subcellular Location Mitochondrial matrix and cytoplasmic side of the mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
GO:0007399
Biological process: neurogenesis
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000016953
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008799.1
Sequence Location 2171452..2174596
Sequence Lenght 3145bp
Relative Gene location 1001 .. 2215
CDS
CDS Location 1098 .. 2215
Sequence Lenght 239aa
Translation MLRLFANTMRLGATRPLSTSAVKMSDNLFVHRDTPEDNASIPFEFTADNQKRAEAILNIY
PEGHKRGAMIPLLDLAQRQHGWLPLSAMHKVADILGLPHMRVYEVATFYTMFMRKPTGKY
HIQVCTTTPCWLRGSDEVLDVCKKNLGIGVGETTKDGKFTISEVECLGACVNAPMLAVND
DYYEDLSVADTEEILNSLKQGQQPRPGPRNGRYASEPVGQLTSLTEEPKGPGFGLQAGL
mRNA
mRNA Location 1001 .. 2204
5'UTR Location 1001..1097
3'UTR Location  --
Exon 1001..1124,1236..1361,1446..1721, 1796..1915,1978..2204
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CAACATCTGTCAACAAAAAAGGGAATTTTCGATTGGCCACTCGTCTTTGCGCTGGTAGAA
AATTTCATCGTTGTAAACCGTACACGGAACAATAGCG
ATGTTGCGCCTGTTCGCCAACAC
CATG
CGACTCGGGGCTACCCGGCCTCTGAGCACGTCGGCGGTGAAGATGAGCGACAACCT
GTTCGTGCATCGCGATACGCCCGAGGATAATGCCAGCATTCCGTTCGAGTTTACCGCAGA
CAACCAGAAG
CGAGCGGAAGCCATCCTGAACATCTATCCGGAGGGTCACAAGCGTGGTGC
GATGATTCCGCTGCTGGATCTTGCCCAGCGCCAGCACGGTTGGCTGCCACTGTCGGCCAT
GCACAAGGTGGCCGACATCCTGGGCCTGCCTCACATGCGCGTGTACGAGGTGGCCACCTT
CTACACGATGTTTATGCGCAAACCGACCGGAAAGTATCACATCCAGGTGTGCACTACCAC
ACCGTGCTGGCTGCGCGGATCCGACGAAGTGCTGGATGTCTGCAAG
AAAAACCTCGGCAT
CGGTGTCGGCGAAACTACCAAGGATGGTAAGTTTACCATCTCTGAAGTGGAATGTCTCGG
TGCATGCGTAAACGCCCCGATGCTGGCAGTCAACGATGATTACTAT
GAGGATTTAAGCGT
GGCTGATACGGAAGAAATTCTAAACAGTCTCAAGCAGGGACAGCAGCCCCGCCCCGGACC
ACGCAATGGACGATACGCCTCCGAACCAGTCGGTCAGCTGACCTCGCTTACGGAGGAACC
GAAGGGTCCCGGCTTTGGGCTACAAGCAGGGCTGTAAGCAATCGCTAAGCGTTATTTTTC
TGTCGCGTCCTAGTTGAAGGAATAAAAAATCGC
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GCTTGACGCTGTGAAGGAATGGTCGCAAAAAATACAGGCAAATCAAAATTACTACCCTGT
TGCGACATCTAAACTCATTCTAGATCGAGCGAAAATGGTATGTGCATAAAAGCAAAACAA
TTACATCTATGCTTTTAGATGCGAGAGGTGAAGTTTTATGCTATGGTTAATATTAGACGC
GCCTAAAAATTCCACCATTAAGCTACCATGGTCGAAAGGAACTTTGCGTCTGTATGAGTG
TGTACGAGTGTGTGTAAGGGTTGCCGATTGACCAACCACATGGTGGCCTACACACTTACA
TCTTGTTGGCCTTTTCCGGTGTTTCGAACTCCAGGTACAGGTTATCGATCTCCTTGAATT
TGTTGTCATCCAACAGCTATACACATGGGACGAAACAAATATTGCTTTAGTTTTTATAAC
CTCAACACACATCCCAGGACATGCTTCCCCGAGCGATGCCATCGATCATACTGCTGTACT
CGCAACGGCAGCACCGGCATGCCAGGAAATTGGTTCAGTTACCTTGAATATGGCATATCC
TGCCGGTGTTTCGTAAAGAACGAACATGGTGCTACACTTTTAGGCTTACGCCAATACTTA
TCAGCTTATTTTTCACTAAAATTTACCGATTCCAGCCAGACGGCGACGCGCTTCGCCTCG
CAAAACCAAAAACAATTCAACAACGTGCTCTCCGTCTGACAGCTGAAGGCCGCTTTGAAA
TGACTGCTTTGCGGTTTGCGTTTACTACCTATAGTTTGGAACTATTGCTTCACACGTTGT
CCGACAGAAAAATGATAAAATAATAATGTTCATAAAGTAGAAAAAACAGATTCAAATTGT
AGTAAAAAATCATAGGAACATATTTAAATGCATGTCGGCTCCGCAGTGCATTTTAAAACG
AAATTATTTCGTCATTCCAATGTGGGTGTTTTAGTTTCCCACGCGAACAAACCCCGAAAC
GTCAAACGTCAGCGTAGAAGAAAACACAACATTGGGTAACCAACATCTGTCAACAAAAAA
GGGAATTTTCGATTGGCCACTCGTCTTTGCGCTGGTAGAAAATTTCATCGTTGTAAACCG
TACACGGAACAATAGCG
ATGTTGCGCCTGTTCGCCAACACCATGGTAAGGAGGGATAGCT
ATATAAACAGTCGGTGGGCATATGTACCGGCCACCGTTGTCGTTTGTTTTGTTTGGCCGA
GCAGTATTACATAAGTTTCGATTGGTTGTTTGCAGCGACTCGGGGCTACCCGGCCTCTGA
GCACGTCGGCGGTGAAGATGAGCGACAACCTGTTCGTGCATCGCGATACGCCCGAGGATA
ATGCCAGCATTCCGTTCGAGTTTACCGCAGACAACCAGAAG
GTAATGCTATGCGCCAAAT
CCAAATAAAAGCGTCGAGCCTGGCCGTGGATTAAACCAGCCCCTTTCCCTTGTTGTTAAT
TGCAGCGAGCGGAAGCCATCCTGAACATCTATCCGGAGGGTCACAAGCGTGGTGCGATGA
TTCCGCTGCTGGATCTTGCCCAGCGCCAGCACGGTTGGCTGCCACTGTCGGCCATGCACA
AGGTGGCCGACATCCTGGGCCTGCCTCACATGCGCGTGTACGAGGTGGCCACCTTCTACA
CGATGTTTATGCGCAAACCGACCGGAAAGTATCACATCCAGGTGTGCACTACCACACCGT
GCTGGCTGCGCGGATCCGACGAAGTGCTGGATGTCTGCAAG
GTAAAGCAAATCGGCGAGC
TATGTACGAACAGCACACAATTAACACCATCCATTATGTTTGTTCATGCTTCTAGAAAAA
CCTCGGCATCGGTGTCGGCGAAACTACCAAGGATGGTAAGTTTACCATCTCTGAAGTGGA
ATGTCTCGGTGCATGCGTAAACGCCCCGATGCTGGCAGTCAACGATGATTACTAT
GTAAG
CATACGCAACAAAGTGAACTATTTGGTGCAGTGATTAACGTTAACGTCCTTTTGCAGGAG
GATTTAAGCGTGGCTGATACGGAAGAAATTCTAAACAGTCTCAAGCAGGGACAGCAGCCC
CGCCCCGGACCACGCAATGGACGATACGCCTCCGAACCAGTCGGTCAGCTGACCTCGCTT
ACGGAGGAACCGAAGGGTCCCGGCTTTGGGCTACAAGCAGGGCTGTAAGCAATCGCTAAG
CGTTATTTTTCTGTCGCGTCCTAGTTGAAGGAATAAAAAATCGC
AAAAAATAATAATTAC
GGATATTGAGTTTCCTGTAAAACGTAGTTCGTATTATTAGCTGCATATATTCCAGTGTAA
TGATGAACGTGAAAGCACGTGCAATTTCAAACGAATTCCAAGAACTTTCGTTTACAAACA
CGGCATTGACCTCGTTATGCGCTCCAGCCAGAAGAAAGGTTCCTGCTAATCACAACCTTT
CTTTGGTCACTCCTCCTGCTACGGCCTGCTGCTTCTCCTTCACCTCTACACGCACACACA
CATACGTACACACACAGCCACATTTGCTTGCTGACGACGTAAACAAACATGCGCTGTCAA
AATCGCCCCCCCCACAGTGCAGAAGGAAAATGTCAAAGTGAGACCCACTTTTTTTACCTT
CCCGTTTGTTTGCATCGAAAAGAGAAATCTTCATCTCAGGGACTCACTAATCTTCGTTCG
TCCGTTTCGGTCAGGATTCTGCACACACACTAGCCAGCATGGCAGGTTCCGCCTTGAGGC
GCCTAATGGCCGAGTACAGGCGTAAGTGTTGGCTGGTGCGATCGTGATGGAGCTGCAGCA
AGTACCCAGCAGAAGGCAGCCCGTACCCCCCTCAAACCTAACGGAGCAGATTACCTTGCT
GCAAATACAGCTGCTTACACGTACAATTTCATCAGCTAATCTTATTTCCTTTCTTTTTGG
CAGAACTTACGCTCAACCCTCCGGAAGGTATCATTGCGGGCCCAATCAGTGAGGAGAACT
TCTTCGAATGGGAAGCGCTAATTACGTGAGTTTCACCTGTTGGTCAAAGTTCAAACACGG
GGGGACGGTGGGCATCCCAGGCAGTGGTGTTGTCCGGTGTAAACCTCACTCGTGCCTGCG
TTTTCATTTCAGCGGCCCGGAAGGAACCTGTTTCGAGGGGGGAATCTTTACAGCCAAACT
GATCTTTCCACCGGACTATCCGCTC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004