login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG12140
Organism Drosophila melanogaster
Gene Name CG12140
Product Electron transfer flavoprotein-ubiquinone oxidoreductase (ETFD) (By similarity)
GENE MAP
Chromosome 2R
Citogenetic Map 46C4
Gene Map
Comment This record is derived from the following: AE003831 RH38923.complete AY113586 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Accepts electrons from ETF and reduces ubiquinone.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Others
EXTERNAL RESOURCES
GO GO:0009054
Molecular function: electron acceptor activity.
GO:0004174
Molecular function: electron-transferring-flavoprotein dehydrogenase activity.
SwissProt AC  --
FLYBASE FBgn0033465
View Sequence REFERENCE SEQUENCE
Scaffold AE003831
Sequence Location  --
Sequence Lenght 4560bp
Relative Gene location 964 .. 3559
CDS
CDS Location 1325 .. 3435
Sequence Lenght 604aa
Translation MSALMKMHRVRRLFSPALARSISDVAKYPRITTHYTLNPREKDERWTEVDMERCVEEVDL
VIVGGGPAGMSAAIRAKQLAAEKDQEIRVCVVEKAAEVGGHILSGAVIDPISLNELIPDW
QEQGAPLNTPVTKDTFSFLTGSGRISIPVFKGWPMDNHGNYVVRLGHLVKWLGDQAEALG
VEIYPGCAASEVLFHEDGSVKGIATNDVGIAKSGAPKDTFARGMELHAKTTIFAEGCRGH
LTKQIMQKFGLNEGSEPQAYGIGLKEVWEIAPEKHQPGLVEHTIGWPLDRFTYGGSFLYH
LNEPTPTIAVGFVVGLNYKNPWLSPFQEFQRFKTHPKVRDVFEGATRIAYGARAINEGGF
QSLPQKLSFPGGCLVGCSAGFLNVPRIKGSHYAMKSGMLAAESAFEAINADAQSTAGVEP
TGYAEKIKDSFVWKDLYSVRNVHPSFHNPLGLYGGLVLSGFSIFMGGREPWTLKHGPQDH
ESLKPASSCPPIVYPKPDGKISFDLLSSVALTGTNHEGDQPAHLTLKDDRIPVDHNLALY
EGPEQRFCPAGVYEYVPNEEGGNMKLQINAQNCIHCKTCDIKDPKQNINWVVPEGGGGPA
YNGM
mRNA
mRNA Location 964 .. 3559
5'UTR Location 964..1324
3'UTR Location 3436..3559
Exon 964..1352,1464..1690,1747..2318,2384..2833,2898..3559
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ACTCATTCTTATCGCCCAGCTGTAAGCATTAAGAAACCGCTGGCTTAAGAATAGAAACCA
AACAGCTTTATTTTTCAGTTTGATTAGTTTATTTCGATTCCAAGTTGGTAATCTCTAGTG
CTGAATACACATAGGCGAACAGTAAATACTGCCAACGAACTTTGGACGGAGCTACGTCAT
CTGGTGGACGGGTCTAAAGTCCAACTTGTTGCACCGATCTCGTTGTTTGTGTTGTGTTTT
GGATTGGAATAAACACAACATCATACACACATACGTAAATAGGAACAGTTTACAGTGAAC
TTCTGCAACTCTAGAACTATTCCCACTGTTAAACCGCTATTATCAGGAAAAGGAGCGAAA
A
ATGTCGGCACTCATGAAAATGCACAGAGTTCGGAGACTCTTCAGCCCCGCTCTGGCTCG
CAGCATCTCCGATGTGGCCAAATATCCCAGGATAACCACCCACTATACGCTGAATCCCCG
CGAGAAGGATGAGCGCTGGACGGAAGTGGATATGGAGCGTTGTGTTGAGGAGGTGGACCT
GGTCATCGTCGGTGGAGGACCTGCTGGAATGTCGGCGGCTATTAGGGCGAAGCAACTGGC
GGCGGAAAAGGATCAG
GAAATCCGCGTCTGCGTAGTGGAAAAGGCCGCCGAAGTTGGCGG
ACATATTCTCTCCGGCGCCGTCATAGATCCAATCTCGCTGAACGAGCTTATCCCGGACTG
GCAAGAGCAGGGAGCTCCTCTAAACACACCCGTGACCAAGGATACTTTCTCCTTCCTCAC
CGGATCCGGCCGCATCTCCATTCCGGTCTTTAAGGGCTGGCCCATGGACAACCATGGCAA
CTACGTAGTTCGCTTGGGCCACTTGGTCAAGTGGCTTGGAGATCAGGCGGAGGCTCTGGG
CGTGGAGATCTATCCCGGCTGTGCTGCCTCCGAGGTGCTCTTCCACGAGGATGGCAGTGT
CAAGGGCATTGCCACCAACGATGTGGGCATTGCCAAGAGCGGAGCTCCCAAGGACACCTT
TGCACGTGGCATGGAGTTGCACGCCAAGACTACCATCTTTGCCGAAGGCTGCCGGGGTCA
CCTGACCAAGCAGATTATGCAGAAGTTCGGACTTAACGAGGGCAGCGAACCACAGGCCTA
TGGAATCGGTCTGAAAGAGGTCTGGGAGATTGCCCCCGAGAAGCATCA
ACCTGGTTTGGT
GGAGCATACCATTGGCTGGCCTTTGGACCGCTTCACATATGGCGGCTCCTTCTTGTACCA
TTTGAACGAGCCCACACCCACCATTGCAGTGGGCTTTGTGGTGGGCTTGAACTACAAGAA
CCCCTGGCTCAGTCCCTTCCAGGAGTTCCAGCGTTTCAAGACGCATCCCAAGGTGCGAGA
CGTCTTCGAGGGCGCCACTCGAATTGCCTATGGAGCACGAGCAATCAATGAGGGTGGCTT
CCAAAGTCTGCCGCAGAAGCTGTCCTTTCCGGGAGGTTGCCTTGTGGGCTGCAGTGCTGG
CTTTTTGAATGTCCCTCGCATTAAGGGCTCCCATTACGCGATGAAGAGCGGCATGCTGGC
GGCGGAGAGTGCCTTTGAAGCCATCAATGCGGATGCACAATCGACGGCTGGTGTGGAACC
CACAGGCTATGCGGAGAA
AATCAAGGACTCCTTTGTATGGAAGGATCTGTACAGTGTGCG
AAATGTGCACCCTTCTTTCCACAATCCATTGGGACTGTACGGTGGTCTTGTGCTCAGTGG
CTTCTCCATTTTCATGGGCGGTCGGGAACCATGGACCCTAAAACACGGTCCCCAGGATCA
CGAGTCCTTGAAGCCAGCTAGCTCCTGCCCGCCCATTGTTTACCCCAAGCCCGATGGCAA
GATCTCCTTCGATCTGCTGTCTTCGGTAGCACTGACGGGCACAAACCACGAGGGCGACCA
GCCCGCCCATCTGACCCTCAAGGACGACCGCATCCCCGTGGACCATAATTTGGCGCTGTA
CGAGGGACCCGAGCAGAGATTCTGCCCCGCTGGCGTTTACGAGTACGTGCCCAACGAGGA
GGGCGGCAACATGAAGCTGCAAATTAACGCCCAGAACTGCATCCACTGCAAGACCTGTGA
TATCAAGGACCCCAAGCAGAACATCAACTGGGTGGTGCCCGAGGGAGGTGGCGGTCCCGC
CTACAACGGCATGTGA
AAGGATAACTATCGCAGCCAATCCGTGTACCGCAATTGCATTTC
ATTAGTTTTTAAAGTTGAGAATTTGAACTTATGATTCGGAATTAAGCCTAAAGTTGCAAT
AAAATTGTAAGAAAAAGTCA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
CAGGATTTTGTGCGCTCCGGGAAGATGGACTCAAACTTCATTCGATTCGGTAAGAGCTTG
AAGCCGGCGGCTCCCGAGTCCAAGCCAGTCAAGTCCAATCAAGGCAACCCAGGCGAACGC
AGTCCAGTGGACAAGGCCATGACGGAGCTGTTCAAGAAACAGGAGCTGCAGGATCAGCAG
GTGAAGAACGGCGCACAGGCGACCACCACGCAGGATGGGAGTGTGGAACAGGACCAGTTC
TTCGGCCAGTGAGGTAGTCCTGCGGGACGCCTCCTTGTAAATAGATATGGACAAATGTAC
GCAAGGATCTAAATTGATATACGTATATAACCCACTCCTCACACGAACTCCTGACTTATG
CCTGAACTATGAATTTTTAATGAATGGGCTGGATTAAAAATTCACCGTGCTTTGAAGTTC
TTATCTATAAATATATCTAGTGTAATATTGAAGAAATTGAAATTGGCGTGAATAAAATCC
TGTGGCAACATTTTAAATAAAGATTGCTTTACTGTAAATTATAGCGCACTCGAATAGTCT
TATTTCATTTCGGTCGAGGTACATATTGTATAGCCATTATTAGTTTCTCCACTGGTCAGA
ATCTGGAGTTCTACAACCATAAGTACATTGGATACTCTTGTAACCAGTATCAAAATATGT
CTACCGTTTACTATATTTCTTCATCTATCATTTAGTTATATTATTTAATATGAATTAGGA
TTTTACCATTATCAAATTTAATCTAATATGCATCTAATATTTTATGTATTGATGATTTAA
TATATACTCCTTTTCTATACAAGGAAAGTTAGAAATGAATTGAAAACTGTTTTCATGTTC
GAATGATAACCACTCTCAAATGCTTGACAACTCTGGTCCGGTTTGTGACATCGCTAGAAT
CTCTTTTGTATACCAGTTTATCAAGATGGGTCGAGTCCGTGGAGAGTGGTCATTTTTAGT
ACCACTCATTCTTATCGCCCAGCTGTAAGCATTAAGAAACCGCTGGCTTAAGAATAGAAA
CCAAACAGCTTTATTTTTCAGTTTGATTAGTTTATTTCGATTCCAAGTTGGTAATCTCTA
GTGCTGAATACACATAGGCGAACAGTAAATACTGCCAACGAACTTTGGACGGAGCTACGT
CATCTGGTGGACGGGTCTAAAGTCCAACTTGTTGCACCGATCTCGTTGTTTGTGTTGTGT
TTTGGATTGGAATAAACACAACATCATACACACATACGTAAATAGGAACAGTTTACAGTG
AACTTCTGCAACTCTAGAACTATTCCCACTGTTAAACCGCTATTATCAGGAAAAGGAGCG
AAAA
ATGTCGGCACTCATGAAAATGCACAGAGGTAAGTGTTCCCAGAACCCAAATTTCAG
GCATTACATAACCGCAAAGATGCCGATAGACCCAGAAACCCATAAAATCGCCTGATTATA
CAATGATCTTATCTCCCACCCAGTTCGGAGACTCTTCAGCCCCGCTCTGGCTCGCAGCAT
CTCCGATGTGGCCAAATATCCCAGGATAACCACCCACTATACGCTGAATCCCCGCGAGAA
GGATGAGCGCTGGACGGAAGTGGATATGGAGCGTTGTGTTGAGGAGGTGGACCTGGTCAT
CGTCGGTGGAGGACCTGCTGGAATGTCGGCGGCTATTAGGGCGAAGCAACTGGCGGCGGA
AAAGGATCAG
GTAAGCTAGTCTCATTATGGCCATCGGAAGTATTCTGAGCACCCGCTTGC
TTGTAGGAAATCCGCGTCTGCGTAGTGGAAAAGGCCGCCGAAGTTGGCGGACATATTCTC
TCCGGCGCCGTCATAGATCCAATCTCGCTGAACGAGCTTATCCCGGACTGGCAAGAGCAG
GGAGCTCCTCTAAACACACCCGTGACCAAGGATACTTTCTCCTTCCTCACCGGATCCGGC
CGCATCTCCATTCCGGTCTTTAAGGGCTGGCCCATGGACAACCATGGCAACTACGTAGTT
CGCTTGGGCCACTTGGTCAAGTGGCTTGGAGATCAGGCGGAGGCTCTGGGCGTGGAGATC
TATCCCGGCTGTGCTGCCTCCGAGGTGCTCTTCCACGAGGATGGCAGTGTCAAGGGCATT
GCCACCAACGATGTGGGCATTGCCAAGAGCGGAGCTCCCAAGGACACCTTTGCACGTGGC
ATGGAGTTGCACGCCAAGACTACCATCTTTGCCGAAGGCTGCCGGGGTCACCTGACCAAG
CAGATTATGCAGAAGTTCGGACTTAACGAGGGCAGCGAACCACAGGCCTATGGAATCGGT
CTGAAAGAGGTCTGGGAGATTGCCCCCGAGAAGCATCA
GTGAGTGACTAAACCAGATTAC
CTAAATAACATGTTTAACCACATAAACATTTCTCCCTCTTCAGACCTGGTTTGGTGGAGC
ATACCATTGGCTGGCCTTTGGACCGCTTCACATATGGCGGCTCCTTCTTGTACCATTTGA
ACGAGCCCACACCCACCATTGCAGTGGGCTTTGTGGTGGGCTTGAACTACAAGAACCCCT
GGCTCAGTCCCTTCCAGGAGTTCCAGCGTTTCAAGACGCATCCCAAGGTGCGAGACGTCT
TCGAGGGCGCCACTCGAATTGCCTATGGAGCACGAGCAATCAATGAGGGTGGCTTCCAAA
GTCTGCCGCAGAAGCTGTCCTTTCCGGGAGGTTGCCTTGTGGGCTGCAGTGCTGGCTTTT
TGAATGTCCCTCGCATTAAGGGCTCCCATTACGCGATGAAGAGCGGCATGCTGGCGGCGG
AGAGTGCCTTTGAAGCCATCAATGCGGATGCACAATCGACGGCTGGTGTGGAACCCACAG
GCTATGCGGAGAA
GTAAGTTTATAGTCTTGTAGCTAGAATAGAACCAACATTTGATAACC
GAAATGCTCTTTCGTAGAATCAAGGACTCCTTTGTATGGAAGGATCTGTACAGTGTGCGA
AATGTGCACCCTTCTTTCCACAATCCATTGGGACTGTACGGTGGTCTTGTGCTCAGTGGC
TTCTCCATTTTCATGGGCGGTCGGGAACCATGGACCCTAAAACACGGTCCCCAGGATCAC
GAGTCCTTGAAGCCAGCTAGCTCCTGCCCGCCCATTGTTTACCCCAAGCCCGATGGCAAG
ATCTCCTTCGATCTGCTGTCTTCGGTAGCACTGACGGGCACAAACCACGAGGGCGACCAG
CCCGCCCATCTGACCCTCAAGGACGACCGCATCCCCGTGGACCATAATTTGGCGCTGTAC
GAGGGACCCGAGCAGAGATTCTGCCCCGCTGGCGTTTACGAGTACGTGCCCAACGAGGAG
GGCGGCAACATGAAGCTGCAAATTAACGCCCAGAACTGCATCCACTGCAAGACCTGTGAT
ATCAAGGACCCCAAGCAGAACATCAACTGGGTGGTGCCCGAGGGAGGTGGCGGTCCCGCC
TACAACGGCATGTGA
AAGGATAACTATCGCAGCCAATCCGTGTACCGCAATTGCATTTCA
TTAGTTTTTAAAGTTGAGAATTTGAACTTATGATTCGGAATTAAGCCTAAAGTTGCAATA
AAATTGTAAGAAAAAGTCA
GACAGTCAGTTGCCAAAAAGGTTTTATTTAAAATGTTCTAC
TGTCATTTGTTCGGTTTTGTTCTCGTTTTTTTGTTTTTCTGTTTAAAACACCAACTTAAT
AGGTAAATATTGAATCCACAATCAATTTGTCAATTTCGAAAACCTTTCATATTCAGTGCA
CGGATAAAACATGTTTCTCATTATATAGTTTCACATATATATGCATTTATGTATAATGTA
CTATCTTGTTTTTCACCAAAACGGTTGCATGTCATTAGCTTAGAGTTACGATTTAGTTGT
ATATGGTTATTAGAACAGACACATCGATGGATACACTTATGTAGGTGACCCTCTCTCTGA
AATGCTCCCTAATCCTGGTGCCTATCCGCATATCACTCCCGGACCTATCTAGAGTTTAGC
TGAACATATTGTACATACATATATGCCGCGGGACTGGATCCCTCAATATTCTCTAAGTGA
GTTCAAGCACAAGTCTTTGAATAACTATTAGATGTTGCTTGTGGGTAGTGCCACATAAAT
TTCATTCATTACAACAGTGCGTAGGTGTAACATAATTTTTTCTAGGTTATATCCTAAAGG
TACAGCGAATACGAATTTACACTCTGGACGATCTGTGTGCAGATCCCGACCTTTGGATTA
CTTCCGTGCTGTGAGTGGTCCCTGTGACCGTAGGACGTCCTTTAGACAGTCAACTGTACA
GTGCGTCGATCGAATATATTCAAATATAAACTCCTAGCAATATATATACTCCATCTTTTA
TTTAACTAGACTACATATATGGGTTTCTTTCTGGGTAAGCCTTCCTCATGCAATGCCAAT
CGAAACGCCCCTTTGTACATTACGTGCTGCTCAGTGGAGGTTATCTCTCTCGGGATTTCA
CTAGGATTGATTTAGGTTAATATCAGTTACCAGATTTATCTACGCTTACTTAAATAGCAC
AATTAACACCTGTATTGAAATTTTTCACCATCAAGTTGTTCGTTATCATTATCATTTGCA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004