login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG12140
Organism Drosophila pseudoobscura
Gene Name Dpse\CG12140
Product Electron transfer flavoprotein-ubiquinone oxidoreductase (ETFD) (By similarity)
GENE MAP
Chromosome pseudo3-mel2R
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig3083_Contig4177 The following contributed to sequence development: bases 1..4320 = Contig3083_Contig4177 890830..886511
PRODUCT
Function Accepts electrons from ETF and reduces ubiquinone.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Others
EXTERNAL RESOURCES
GO GO:0009054
Molecular function: electron acceptor activity.
GO:0004174
Molecular function: electron-transferring-flavoprotein dehydrogenase activity.
SwissProt AC  --
View Sequence REFERENCE SEQUENCE
Contig Contig3083_Contig4177
Sequence Location 890830..886511
Sequence Lenght 4319bp
Relative Gene location 1010 .. 3238
CDS
CDS Location 1010 .. 3238
Sequence Lenght 604aa
Translation MSALLKINRVQRLFTPALVRSVSEAAKYPRITTHYTLNPREKDGRWKEVDMERCIEEVDI
VIVGGGPAGMSAAIRAKQLAAEKDQEIRVCVVEKAAEVGGHILSGAVVDPISLNELIPDW
QEQGAPLNTPVSKDTFSFLTSSGRISIPIFKGWPMDNHGNYVVRLGHLVKWLGDQAEAMG
VEIYPGCAASEVLFHEDGSVKGIATNDVGIAKTGAPKDTFARGMELHAKTTIFAEGCRGH
LTKQVMQKFNLNEGSEPQAYGIGLKEVWEIAPEKHQPGLVEHTIGWPLDRFTYGGSFLYH
LNEPTPTIAVGFVVGLNYKNPWLSPFQEFQRFKTHAKVRDIFDGATRIAYGARAINEGGY
QSIPQKLSFPGGCLVGCSAGFLNVPRIKGSHYAMKSGMLAAESALEAINADSQSTAGVEP
TSYADKIKDSFVWKDLYKVRNVHPSFHNPLGLYGGLVLSGFSIFMGGREPWTLKHGPQDH
ESLQLASASEPIVYPKPDGKVSFDLLSSVALTGTNHEGDQPAHLTLKDDRIPVDHNLALY
EGPEQRFCPAGVYEYVPNEEGGNMKLQINAQNCIHCKTCDIKDPKQNINWVVPEGGGGPA
YNGM
mRNA
mRNA Location 1010 .. 3238
5'UTR Location  --
3'UTR Location  --
Exon 1010..1037,1259..1485,1558..2129,2193..2642,2701..3238
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
TGTCTGCGCTGCTGAAAATTAACAGAGGTCAAAGGCTCTTCACGCCCGCCCTAGTGCGCA
GCGTGTCAGAGGCCGCCAAATACCCGAGGATTACCACACACTACACGTTGAATCCCCGGG
AGAAGGATGGACGGTGGAAGGAGGTCGACATGGAGCGCTGCATCGAGGAGGTAGACATTG
TCATTGTTGGAGGGGGACCGGCGGGCATGTCGGCAGCCATCCGGGCCAAGCAGCTGGCTG
CTGAGAAAGATCAGG
AGATTCGAGTCTGCGTTGTGGAGAAGGCAGCGGAGGTGGGTGGAC
ACATACTCTCCGGAGCTGTTGTGGATCCCATCTCGCTGAACGAACTGATACCTGACTGGC
AGGAGCAGGGCGCCCCGCTGAACACGCCCGTGAGCAAGGACACCTTCTCCTTCCTCACCT
CCTCGGGTCGCATCTCCATACCCATCTTCAAGGGATGGCCCATGGACAACCATGGAAACT
ATGTGGTGCGTCTCGGCCACCTCGTCAAATGGCTTGGTGATCAGGCCGAGGCGATGGGTG
TAGAGATCTATCCCGGCTGTGCCGCGTCCGAAGTGCTCTTCCACGAGGACGGCAGCGTCA
AGGGCATTGCCACCAACGATGTGGGCATTGCCAAGACTGGGGCGCCCAAGGACACCTTTG
CCCGCGGCATGGAGCTTCATGCGAAGACCACCATCTTCGCCGAGGGATGTCGTGGCCACC
TCACCAAGCAGGTCATGCAAAAGTTCAACTTGAATGAAGGCAGCGAGCCACAGGCCTACG
GAATCGGTCTGAAAGAGGTCTGGGAGATTGCCCCCGAAAAGCATCAG
CCCGGTTTGGTGG
AACACACCATTGGCTGGCCCTTGGATCGATTCACCTATGGTGGATCTTTCCTGTATCACC
TGAACGAGCCCACCCCTACGATAGCTGTCGGCTTTGTGGTCGGCCTGAACTACAAGAATC
CCTGGCTAAGTCCGTTCCAGGAGTTCCAGCGATTCAAGACGCATGCCAAGGTTCGCGATA
TATTCGACGGTGCCACCCGCATTGCCTATGGAGCCCGGGCCATCAACGAGGGCGGCTACC
AGAGCATACCCCAGAAGTTGTCCTTCCCCGGCGGCTGCCTGGTGGGCTGCAGTGCCGGTT
TTCTAAATGTTCCCCGCATCAAGGGCTCCCACTATGCCATGAAGAGTGGCATGCTGGCGG
CGGAGAGCGCGTTAGAGGCCATCAATGCCGACTCCCAGTCCACCGCTGGCGTGGAGCCGA
CAAGCTACGCGGATAAG
ATCAAGGATTCATTTGTGTGGAAGGATCTGTACAAGGTGCGTA
ATGTCCATCCCTCGTTCCACAATCCATTGGGCCTGTACGGCGGTCTAGTCCTGAGTGGCT
TCTCCATTTTCATGGGCGGCCGGGAGCCCTGGACCCTGAAGCACGGTCCCCAGGATCACG
AATCGCTGCAGCTGGCCAGCGCCAGTGAGCCCATTGTCTACCCCAAACCCGATGGCAAGG
TATCCTTCGACCTGCTTTCATCGGTGGCCCTCACCGGCACCAATCATGAGGGCGACCAGC
CAGCACATCTCACGCTGAAGGACGACCGCATTCCCGTCGATCACAACCTGGCTCTGTACG
AGGGTCCCGAGCAGCGTTTCTGCCCCGCCGGCGTGTACGAGTACGTGCCCAACGAGGAGG
GCGGCAACATGAAGCTGCAGATCAACGCTCAAAACTGCATCCACTGCAAAACATGTGATA
TCAAGGATCCCAAGCAGAATATCAACTGGGTGGTACCCGAGGGAGGTGGCGGCCCCGCCT
ACAATGGCATGTGAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TGAATCGGGTAGAATCGGTAATAACCGGTTCACAACAATGTCCATGCACACATACCCTGG
GAGAAATGGATGTTTTAGAGTTGTGAATATGTTTGTCATTCCAAACTCCAAAGAAAGCAA
AAACAATTTAGTCTCTGTTTTAAACATATTTCAACGATATTCGAAGCTTTTTTTTTCTTG
CAGGGAGCAAGAATAGGTATCAGGATCGAGATATATATATACAATATACCAATAATAAAC
CTGAATATGTCTAAAAAATGTCATTTTGAGATAAGGTCTTTATTAGCTACGTTTTATCTT
CATACCATATTTACACTTTCATATAAAATTAACAAAATAGGGTATACACAGGCCTATACT
AGGGCTTACACGCAACATAGTACTGTTTTTCTTGTTGAACTATTTTGTGTAAGCCTTGTT
TTAGTCAAAATACAATAAAAGCAAGGACTAAAAACTAACTAATTGTGTAGCAAATTTATT
CATCAATAGGCTAAAATTATGTGGGCACGTCTAAATGTTCTATATAGCTGGTAATATTCA
GCGGAAGATAAAAAATGAGGAATATGTTAAATAGACCTTGAATTCGTCAGTATATTAAAG
GTATATTTTGGTATATTCCTGAGGGCCAGGCGGTATGTCTTATCAGCTGTCCACAGTTTC
CACCTGATAGCGTTCGATCCATTGCTGTTTTTTTGATTGGATTGGCAAATTCTATCAATA
GATTCCAAATTAGATCTTGCTATCTGAAGTGGATTGGCGCATTAGTCAACGGTAAACATA
TTGCATGTGAACTTTAGCACCGGCGCCTACGTCAGTCTACCTATTGAGGGGTCTAAAGTC
CAACCTGTTGCATCGCTCTGATCTTGTTCTTGTTCTTCTTTTGTGTATGTTTTGGAAAAG
TGTAAATACAGATATATATATATATTTATATCCGGGAACCGCACAGCGCAGTGGCCGCCT
TTTCCAAGCTCTAGAAACCATTGCAAGTGGCCGCCAGGAGGAAGAAATATGTCTGCGCTG
CTGAAAATTAACAGAGG
TGAGTGGATCTTTGCCAAGGTAGTCTCTTTCGCCCGACAACAA
ATTTGGTGGATTACATAACCGAAATGACGATCAGGCAATGTGCAACAATAAAAACATACT
GGTCAGCGGAAGACACGAGACAAAGATAGAGTCTGTGGTCAGTTCTTATCAGGCCATGGA
ATTTTCCCCTGATCCAGTGATTGATTCTTGTCTGTCTCTCTGTCTCCTCCTAAACAGTTC
AAAGGCTCTTCACGCCCGCCCTAGTGCGCAGCGTGTCAGAGGCCGCCAAATACCCGAGGA
TTACCACACACTACACGTTGAATCCCCGGGAGAAGGATGGACGGTGGAAGGAGGTCGACA
TGGAGCGCTGCATCGAGGAGGTAGACATTGTCATTGTTGGAGGGGGACCGGCGGGCATGT
CGGCAGCCATCCGGGCCAAGCAGCTGGCTGCTGAGAAAGATCAGG
TGAGTGGGCAACCAC
ATACGGCAATGGATGTGATGTGCTGACCAGCGTGCATACTTTTCTTATCCCCGCAGGAGA
TTCGAGTCTGCGTTGTGGAGAAGGCAGCGGAGGTGGGTGGACACATACTCTCCGGAGCTG
TTGTGGATCCCATCTCGCTGAACGAACTGATACCTGACTGGCAGGAGCAGGGCGCCCCGC
TGAACACGCCCGTGAGCAAGGACACCTTCTCCTTCCTCACCTCCTCGGGTCGCATCTCCA
TACCCATCTTCAAGGGATGGCCCATGGACAACCATGGAAACTATGTGGTGCGTCTCGGCC
ACCTCGTCAAATGGCTTGGTGATCAGGCCGAGGCGATGGGTGTAGAGATCTATCCCGGCT
GTGCCGCGTCCGAAGTGCTCTTCCACGAGGACGGCAGCGTCAAGGGCATTGCCACCAACG
ATGTGGGCATTGCCAAGACTGGGGCGCCCAAGGACACCTTTGCCCGCGGCATGGAGCTTC
ATGCGAAGACCACCATCTTCGCCGAGGGATGTCGTGGCCACCTCACCAAGCAGGTCATGC
AAAAGTTCAACTTGAATGAAGGCAGCGAGCCACAGGCCTACGGAATCGGTCTGAAAGAGG
TCTGGGAGATTGCCCCCGAAAAGCATCAG
TGAGTGGCTGCCTTATAAGTGTGAAAATATA
CCATTTCTTATAATAATGGAATGCGTTTCAGGCCCGGTTTGGTGGAACACACCATTGGCT
GGCCCTTGGATCGATTCACCTATGGTGGATCTTTCCTGTATCACCTGAACGAGCCCACCC
CTACGATAGCTGTCGGCTTTGTGGTCGGCCTGAACTACAAGAATCCCTGGCTAAGTCCGT
TCCAGGAGTTCCAGCGATTCAAGACGCATGCCAAGGTTCGCGATATATTCGACGGTGCCA
CCCGCATTGCCTATGGAGCCCGGGCCATCAACGAGGGCGGCTACCAGAGCATACCCCAGA
AGTTGTCCTTCCCCGGCGGCTGCCTGGTGGGCTGCAGTGCCGGTTTTCTAAATGTTCCCC
GCATCAAGGGCTCCCACTATGCCATGAAGAGTGGCATGCTGGCGGCGGAGAGCGCGTTAG
AGGCCATCAATGCCGACTCCCAGTCCACCGCTGGCGTGGAGCCGACAAGCTACGCGGATA
AG
TGAGTGGAATGGATTAACTTAAATGGAAATGTATGTAATGAAACTCACTCAATGCAGA
ATCAAGGATTCATTTGTGTGGAAGGATCTGTACAAGGTGCGTAATGTCCATCCCTCGTTC
CACAATCCATTGGGCCTGTACGGCGGTCTAGTCCTGAGTGGCTTCTCCATTTTCATGGGC
GGCCGGGAGCCCTGGACCCTGAAGCACGGTCCCCAGGATCACGAATCGCTGCAGCTGGCC
AGCGCCAGTGAGCCCATTGTCTACCCCAAACCCGATGGCAAGGTATCCTTCGACCTGCTT
TCATCGGTGGCCCTCACCGGCACCAATCATGAGGGCGACCAGCCAGCACATCTCACGCTG
AAGGACGACCGCATTCCCGTCGATCACAACCTGGCTCTGTACGAGGGTCCCGAGCAGCGT
TTCTGCCCCGCCGGCGTGTACGAGTACGTGCCCAACGAGGAGGGCGGCAACATGAAGCTG
CAGATCAACGCTCAAAACTGCATCCACTGCAAAACATGTGATATCAAGGATCCCAAGCAG
AATATCAACTGGGTGGTACCCGAGGGAGGTGGCGGCCCCGCCTACAATGGCATGTGAA
TG
GCAATCATTGATTCAGATTCAGATTTAGATTGAGATTAGGAAATCATCTCCTGTACCGCA
ATTGCATTTGATTAGTTTGTAAAATTGAGAATTTGATAACACGATTTGGAATTTAAGCTA
TAAAGTTGCAATAAAATTGTAGATAAAGTGAAAAGTCAGTTGCCAAAAAGGTTTTATTTA
AAATGTTCTACCATCGTTTTTTCGGTTTCTGTTGTTCTTGTTTCTTGTTTAAAACACCAA
CTTAATAGGTAAATACAATAAATTTTCAATTTCAAAACCTTTCATATATATTCAGTGCAC
GGATAAAACTTGTTCTCTTTTTATATAGCTTCACATATATGTATATATAAGTATGTATTG
TATAATATACTATCTTGTTTTTCACCAAAATGGTTTGCAATGGTTTGCTTAGCCGACAAT
TACGATTTAGTTGTATAATTTGTATTACTTTATTTGTTATTTGAACAGACGATACATCGA
TGGATACATGGCCTATCCTAACATTTGTGCGCCTTCGCATATCCTTTTTCTTAGACCTAT
CTATAGATTTACCATATCTGCTCAATGGGCTGGCGTCACGGCTGCCACTGGAACATTTAT
TGGACCACAATCACGGAAATTCAGAAAGAACTAGGGGATCTTTAATACTAACATTCCATA
ACAGGGAGGTTGCTATCTGGCATTTCGTCACCAAGGGACAAGTTTTGCTACCTTTTGGGT
GCCATCTGTGGCAGCCGTGGTGCTGGAGCTGCAGACCCATGCTGATGGCCGTGTGTTACA
AGTCTTTGTTTAATTCTTATATGATGCTGTTCAGGTGCCAATTAAATCCCATTACAACAG
TGCAACATGCAACAGGTTCAACATTTTATCTATTACACTAAAGGTACAACGAGTACAATA
CAATTTACATTCTGAACATTACAATTAGTACCATACGAACGCAGTTAGTGTAGTCTGTCT
GTGCTGTGAGTGGTCCCTGTGACCGTAGATCGTCTTGTAGACTGTCATCTGTACAGTGCA
TCGTTATTCATACACACATTTGCGTACATATGTATGTATATATTAGCTATGTAAACTAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004