login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG5703
Organism Drosophila pseudoobscura
Gene Name Dpse\CG5703
Product NADH-ubiquinone oxidoreductase 24 kDa subunit (NUHM) (By similarity)
GENE MAP
Chromosome pseudoXL-melX
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig7446_Contig2444 (WGS as of 2003 08 28) The following contributed to reference sequence development: bases 1..2760 - Contig7446_Contig2444 3254733..3251974
PRODUCT
Function Transfer of elecrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Component of the flavoprotein-sulfur (FP) fragment of the enzyme.
Subcellular Location Mitochondrial matrix and cytoplasmic side of the mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
GO:0007399
Biological process: neurogenesis
SwissProt AC  --
HGSC (Dpseudoobscura) Contig7446_Contig2444
View Sequence REFERENCE SEQUENCE
Contig Contig7446_Contig2444
Sequence Location 3254733..3251974
Sequence Lenght 2760bp
Relative Gene location 1013 .. 1819
CDS
CDS Location 1013 .. 1819
Sequence Lenght 248aa
Translation MRAIATSGVQRSDNLFVHRDTPEDNPNIPFEFTAENKKRVEAIMSIYPEGHKRGAMIPLL
DLAQRQYGWLPLSAMHKVAEILELPNMRVYEVATFYTMFLRKPTGKYHIQVCTTTPCWLR
GSDEILETCKKQLGIGIGEISKDKKFTISEVECLGACVNAPMVAVNDDYYEDLTAKDMQD
ILRDLKADKISPPGPRNGRFASEPKGKPTSLTEEPKEAGFAVQRCVEFGDEPENDEKGGP
GKEAPKKP
mRNA
mRNA Location 1013 .. 1819
5'UTR Location  --
3'UTR Location  --
Exon 1013..1522,1583..1819
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGCGCGCCATTGCCACCAGCGGTGTCCAGCGCAGCGACAATCTGTTTGTGCATCGCGAC
ACACCGGAGGACAATCCCAACATACCGTTCGAGTTCACGGCGGAGAACAAGAAGCGTGTG
GAGGCCATCATGAGCATATATCCGGAGGGGCACAAGCGCGGCGCCATGATCCCGCTGCTG
GATTTGGCCCAGCGCCAGTACGGCTGGCTACCATTATCGGCCATGCACAAGGTGGCCGAG
ATCCTTGAACTCCCAAACATGCGCGTCTACGAGGTGGCCACATTCTACACAATGTTCTTG
CGCAAGCCCACCGGAAAGTACCACATTCAGGTGTGCACCACAACACCCTGCTGGCTGCGC
GGATCCGATGAGATCCTCGAGACATGCAAGAAGCAGCTGGGCATCGGCATCGGGGAGATC
AGCAAGGACAAGAAGTTCACCATCTCCGAGGTGGAGTGCCTGGGTGCATGCGTCAATGCA
CCCATGGTGGCGGTCAACGATGATTACTAT
GAGGATCTGACCGCCAAAGATATGCAGGAT
ATACTGCGGGATCTGAAAGCAGACAAGATATCGCCACCTGGTCCACGCAATGGGCGCTTC
GCTAGCGAGCCCAAGGGCAAGCCCACATCATTAACCGAAGAGCCTAAGGAGGCTGGTTTC
GCTGTCCAACGTTGCGTAGAATTTGGGGATGAGCCGGAAAACGACGAAAAAGGAGGGCCC
GGAAAGGAAGCCCCCAAAAAGCCTTAG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
CTTTGATCTCCTCCATGACCGCCCCCTGCTTGAGGTGTACAGTTAATCGCAGAATGTCTT
GGATTTGTGCTTCAGTCATATGGTTTTCTATGTCTAGGATACGGCCATAGCAGGCAGTCG
CTATTTTCGCTGCCAATTCTGTCTCGAACCTGCACTCCTCCATGGATTTAGCCGCCTTTC
TGACCAGTTTCGCATCTACTTTCTGATCCTCTAGCTGTAACTGTAGTCCTGTGTAGTAAA
AAATGTTTGTGGGGGTGTGTGTGTATAAGTGCGGGAATGTGTTTATTTTATTGCAGAGCT
TGCGTACGGTTTACGCTGTGCTTCAGTTTTTTATTGTGCTGCAGTGCTTCTTCGAACTCC
TGCATAGACTGGCCTATTTTGGGATATCTGGCGCACATATTGCCCATGTGCGCCATTACT
GCCGGCATTTTATCCATGTTTTCAGTTTATTTTAATTTCGTTTTGTCGCAATGGCGTCGT
TTCGGTTAGGATTGAATTATATCGATAGCTGTATCGATTTATCCTCTTCAGTACTGGAAA
ACGCTTAGCAAATACTATCGGTATTGTGGTTTTTATTGTTATTATTATATTTAATGCCAG
AAAATACGGTAAAAGTAACGTTTTATAAAAAAAGAAACAAAAAGCTTTTAGTGCTTTTAC
GTGGACAATAATTTGTAACGCACATTTCGCTCTAATCTGGCAGCGCAGAACAGTGCTGTA
AAGCGTGCACTGAAACAGCTGTAAGCGGTGCTTGTTGAAAACCGACTATATTTTCATATA
ACAGCAAATTTTCACATTGCCTTCGTAGAGTTGTTTCGACTGGGAAACGCTAAAATGCTG
ACGAGTTGTGCCTCGAAGACGCTGGCCGCCGTGGTAAGTAGCAGTAGCCCAGGGCGGCCC
CACCACTGCCAGTGACACGGATAGCCAGTCGCCTCCGTGGGTTATATAATTTAGGCATAG
AAAAACAATAACATTTAACATCGTGCCCATCGTATGTTTGCAGCGCGGCGGCATGCGCGC
CATTGCCACCAGCGGTGTCCAGCGCAGCGACAATCTGTTTGTGCATCGCGACACACCGGA
GGACAATCCCAACATACCGTTCGAGTTCACGGCGGAGAACAAGAAGCGTGTGGAGGCCAT
CATGAGCATATATCCGGAGGGGCACAAGCGCGGCGCCATGATCCCGCTGCTGGATTTGGC
CCAGCGCCAGTACGGCTGGCTACCATTATCGGCCATGCACAAGGTGGCCGAGATCCTTGA
ACTCCCAAACATGCGCGTCTACGAGGTGGCCACATTCTACACAATGTTCTTGCGCAAGCC
CACCGGAAAGTACCACATTCAGGTGTGCACCACAACACCCTGCTGGCTGCGCGGATCCGA
TGAGATCCTCGAGACATGCAAGAAGCAGCTGGGCATCGGCATCGGGGAGATCAGCAAGGA
CAAGAAGTTCACCATCTCCGAGGTGGAGTGCCTGGGTGCATGCGTCAATGCACCCATGGT
GGCGGTCAACGATGATTACTAT
GTAAGTGAACAGTGGACAGCACATAATTAAAATATATC
TTTAACCCTTTGTCTTTTGCAGGAGGATCTGACCGCCAAAGATATGCAGGATATACTGCG
GGATCTGAAAGCAGACAAGATATCGCCACCTGGTCCACGCAATGGGCGCTTCGCTAGCGA
GCCCAAGGGCAAGCCCACATCATTAACCGAAGAGCCTAAGGAGGCTGGTTTCGCTGTCCA
ACGTTGCGTAGAATTTGGGGATGAGCCGGAAAACGACGAAAAAGGAGGGCCCGGAAAGGA
AGCCCCCAAAAAGCCTTAG
GTTAGGCTTCAGAGCAAATCCTATTCACAGATTGTCGAAGG
AAAAAGTTAAATAAACGTTAAGCAACTCCAAGAAACAAGGTTCAACCTATAAATAATTGC
TAAAAATTTACCCTTTTTTCTTACTTTATGTTGTTTATGGTTCTTTATATTTTGTGATTC
GATGAAGAGCTAAAAGATGTTCCTATTACCTGGAAATTGTACAGAAAGCATTTAAGAGTC
TGAAAACACTTCATGTCCTGCGATATGCTTATGTTTCCGTTTTTCCGTATATCATTTTTG
GGTTTATAAGTATTTCCAGTAGTTCTCTAGAATTTTTTCTGTTCTGTTTGCCGTAAAAAA
AGGTCCCATCAGCGGATCTCTGAGATCAATTATAGGACATTCTCTTTTATGCTATCCGCT
TGTGCGTGTCGAGTCGAGCATCAAATGGAGCAAGCAGTCGAATGGGAGCAAGGAAGTACG
CAAATATTGTAAGAAATTAAGCTTGAAATCCCTTTTAAACCACGCTTCCAATTGCCTGTT
CAACTTTAAAGAGTTGCCAAATTGGACAATCCATTGACGAATGGATCAAAAAGAGCTACG
AAATTCCATTCAGATACGTTAACTTTGCTAATTAGACAACTTATTTGACAGTCGAAGGAG
GACAGTACGGGAGGATTGTATTATATTGTGTACACACATTATTTTATTTATTAATTATAC
ATTAAGAGGCGACTCGACTGCGCCCTACTATACTGATGCGCATACACTCTTAACACCGGT
GTATATGCTTTAGAAGGGTAGTACTACGTTGATAGTGCGTTCAGATGCACTAAAATCTTA
CAAACTAGTGCCAGTTTACTCTTCGAACGCAGTTCTGGAACAGGCGCGGTGCTGCTGCTG
TGTCTGATACGTGTGTCCTGTCCATGGCACTCCTCCACACACTCGCCTTTTACTCATAGT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004