login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG10998
Organism Anopheles gambiae str. PEST
Gene Name agEG10998
Product Electron transfer flavoprotein-ubiquinone oxidoreductase (ETFD) (By similarity)
GENE MAP
Chromosome 2L
Celera Gene agCG54242
Citogenetic Map 23B
Gene Map
Comment This record is derived from the following: gb|AAAB01008960.1 gb|BM617825.1 5', mRNA sequence gb|BM653869.1 5', mRNA sequence gb|BM618683.1 5', mRNA sequence gb|BM619465.1 5', mRNA sequence gb|BM614447.1 5', mRNA sequence gb|BM607303.1 5', mRNA sequence The following contributed to sequence development: bases 1..4560 = AAAB01008960.1 9285534..9280975
PRODUCT
Function Accepts electrons from ETF and reduces ubiquinone.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Others
EXTERNAL RESOURCES
GO GO:0009054
Molecular function: electron acceptor activity.
GO:0004174
Molecular function: electron-transferring-flavoprotein dehydrogenase activity.
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000010998
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008960.1
Sequence Location  --
Sequence Lenght 4560bp
Relative Gene location 881 .. 3514
CDS
CDS Location 1233 .. 3414
Sequence Lenght 607aa
Translation MARNMLNIAKYTRTLLQRPQLRHYSEASAQFPKITTHYTIHPRDKDPRWGEVDMERFVDE
ADLLIVGGGPAGLSAAIRAKQLAAEKGQELRVCLVEKAAEVGGHILSGACLDPVALNELI
PDWKEKEAPLNTPVTHDKFSYLTESAKLPIPIFPGWPMDNRGNYVVRLGHVVAWLGQQAE
ELGVEIYPGTAASEILYHEDGSVKGIATGDVGIGKDGAPKDTFARGMELHAKTTIFAEGC
RGHLSKQVMARFGLNAENDPQTYGIGLKEVWEIKAENHKPGLVEHTIGWPLDRHTYGGSF
LYHLNEPTPLVAVGFVVGLDYVNPYLSPFQEFQRFKTHPKVRGTFEGGSRIAYGARALNE
GGFQSIPKLTFPGGCLVGCGAGFMNVPRVKGSHYAMKSGMLAAESACEAIFSGATQEKAG
LEPKDYPDRIKESYVWKDLYKVRNSRPSFHTGLGLFGGVAYSGFSILVGGREPWTLHHGS
PDHTRLKPAKDCKPIEYPKPDGKLTFDLLSSVALTGTNHEGDQPAHLTLKDDTVPVKNNL
TIYDGPEARFCPAGVYEYVANDEGGNMKLQINAQNCIHCKTCDIKDVTQNINWVVPEGGG
GPAYNGM
mRNA
mRNA Location 881 .. 3514
5'UTR Location 881..1232
3'UTR Location 3415..3514
Exon 881..1263,1483..1602,1672..2806,2877..3514
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GAACCGCTTCAATCGCTGGTCAGCCCGAAGTCCACGATTACACCACGACCGCCATCGGCA
AGCACGAACGCCCAAGCGAACCGACCGAGCGGACGCACTTTCCTTGCGATCGGTGCGCCA
AAGCCGCGAGATCAATTGAGAGGTGTTGTTGGTGCTTGATTTCATTCGACACAGTGCGAA
ACCAACTTCCGCGAGTGTTCCAGACGCTTCCCTTATCCGCTGCACGCGAGGTTTAAAAAT
TGGAGCCTTTGCAGTAGAGGAAGGCTGCTTAATTACATAACGAAACAAAAAAAAAAGAAG
GTGTTTGCCTGTTGCCTCGAATTGTGAGGGAGGACGTACATATACGAACAAC
ATGGCTCG
AAACATGCTCAACATTGCCAAGT
ATACTCGAACACTGCTCCAGCGGCCACAACTTCGCCA
CTATTCCGAAGCCTCCGCACAGTTCCCGAAAATCACCACCCACTACACGATTCACCCGCG
GGATAAGGATCCACGATGGGGAG
AGGTCGACATGGAGCGTTTCGTCGACGAAGCGGATCT
GCTCATCGTGGGCGGTGGTCCGGCCGGTCTCTCCGCAGCGATCCGGGCAAAGCAGCTAGC
GGCGGAGAAGGGCCAGGAGCTGCGCGTCTGTCTCGTGGAGAAGGCGGCTGAGGTCGGTGG
CCACATCCTGTCCGGCGCCTGTCTCGATCCGGTCGCCCTGAACGAGCTGATCCCGGACTG
GAAGGAAAAGGAAGCCCCACTCAACACGCCCGTCACGCACGACAAGTTCTCCTACCTCAC
CGAGTCGGCCAAGCTGCCCATTCCGATCTTTCCCGGCTGGCCGATGGACAACCGGGGCAA
CTACGTCGTGCGGTTGGGTCACGTCGTGGCCTGGCTCGGCCAGCAGGCGGAAGAGCTCGG
CGTGGAGATCTACCCCGGTACGGCCGCCTCGGAGATACTGTACCACGAAGACGGCTCGGT
GAAGGGCATCGCCACCGGCGACGTCGGCATCGGGAAGGACGGTGCGCCGAAGGATACGTT
CGCGCGCGGCATGGAACTGCACGCGAAGACGACCATCTTTGCGGAGGGTTGTCGGGGCCA
CCTGTCCAAGCAGGTGATGGCCCGCTTTGGGCTGAACGCGGAGAACGACCCGCAAACGTA
CGGCATCGGGCTGAAGGAGGTGTGGGAGATCAAGGCGGAAAACCATAAGCCGGGGCTGGT
GGAGCACACGATCGGGTGGCCGCTGGACCGGCACACGTACGGCGGCTCGTTCCTGTACCA
TCTGAACGAACCGACGCCGCTGGTGGCGGTCGGGTTCGTGGTGGGGCTGGACTACGTCAA
CCCGTACCTGAGCCCGTTCCAGGAGTTCCAGCGGTTCAAGACGCACCCGAAGGTGCGCGG
CACGTTCGAGGGCGGCAGCCGCATTGCGTACGGTGCGCGGGCACTGAACGAGGGCGGCTT
CCAGAGCATTCCGAAGCTGACGTTCCCGGGCGGCTGTTTGGTGGGGTGCGGCGCCGGCTT
CATGAACGTGCCGCGCGTCAAGGGCAGCCACTATGCGATGAAGAGTGGCATGCTGGCGGC
GGAGAGTGCTTGCGAGGCAATCTTCTCCGGGGCGACGCAGGAAAAGGCGGGCCTAGAACC
GAAGGACTATCCCGATCG
CATCAAGGAATCGTACGTGTGGAAGGATCTGTACAAGGTGCG
AAACTCCCGGCCCAGCTTCCACACCGGGCTCGGCCTGTTCGGCGGTGTGGCATACAGTGG
TTTCAGCATTCTGGTCGGCGGGCGGGAACCGTGGACGCTGCACCACGGTTCACCCGACCA
CACCCGCCTGAAGCCGGCAAAGGACTGCAAACCGATCGAGTATCCGAAACCGGACGGCAA
GCTGACGTTCGATCTGCTCTCCTCGGTGGCGCTGACCGGCACCAACCACGAGGGCGACCA
GCCGGCCCATCTGACGCTCAAGGACGACACGGTGCCGGTGAAGAACAATCTAACGATTTA
CGACGGCCCGGAGGCACGCTTCTGCCCGGCCGGCGTGTACGAGTACGTGGCGAACGACGA
GGGCGGCAACATGAAGCTGCAGATCAACGCGCAGAACTGCATCCACTGCAAGACATGCGA
CATTAAGGACGTCACGCAGAACATCAACTGGGTCGTGCCGGAGGGTGGCGGCGGCCCGGC
CTACAACGGCATGTGA
GCGGGCGGTTTTTGTTGCGGTCTTCCACGTCGCTGGGCGGACCT
TCCGGTCGAATTTATTGTGTTAAGAAGAATAAAGTTTCCCATTTGTAATTTGCGCA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GGAGGCCGCGACAAGTGCAGCAGTACCGATCAGGATTGTCTCACGTTAAAAAGTGTGCAT
TTGACCCAAAATTACTCATGCTCATGACATTGATTTCTTTGAGAACGGGAATATTCTATG
TGCGTAAGCATCTTCAAAGCATGTCTCCAAATTTTATGAATGAACGTGAGAAAACCAGGA
TCTTCATTAGTTTGCTGTATTTTGGAAGGATCCAATTGAAATAGTCTTTGCCCTTGTCGG
CATTCGCTGAGCCGGTGTATCCTTTTGTCGGCAATTGCTTTGATGATCCTTGAAAATTGG
TTTTTGATAAGCCGGCTCCGTGTTTGACATCCCTGGAAATCTGGTTTTTCTCTGTTTTGA
TTAATGATAAAGGATACAAAAATGAGAGGAAATACAATTTTATATTCAATCATTTCCATA
CACATTTAATAAACATTCTTGGTAAAAAAGAGTTTTAAATACCAAACGGTGTTTTCAACG
AGCAAAACCGAACATCGAGAACAGTTGTAACGGTTGCGATAGCCGTGAGTTTAAATTTCA
ATCAGACGTTTCAAACGTTACGCGCCCTTCGACCGTTTTTTGACAGCTGCACGCCAGGTG
GGGGACGGAAAATACATTTTCCCTTCGCTTCTTCTAATTATAAATGCACGACACTAAAAA
AAAGTGTAGTATCATGTAAATAAACAATAAAGGATCCCCATTTCCGCCCCAAATCCTAAA
CCGAACCGAGTGAGCAAAGGTCAGTGGGGCGCGAGATTCCGACGGCCGTCGCAACTTGCA
ACCGGCCAAGAACACACGACCGAGAAGGAGAAGAAGAAGAAGAAGAAGTTATCATTCCCT
TTCAATCAACAAAACACAATCGCTGCTCAGCTGTGTTTTGGAACCGCTTCAATCGCTGGT
CAGCCCGAAGTCCACGATTACACCACGACCGCCATCGGCAAGCACGAACGCCCAAGCGAA
CCGACCGAGCGGACGCACTTTCCTTGCGATCGGTGCGCCAAAGCCGCGAGATCAATTGAG
AGGTGTTGTTGGTGCTTGATTTCATTCGACACAGTGCGAAACCAACTTCCGCGAGTGTTC
CAGACGCTTCCCTTATCCGCTGCACGCGAGGTTTAAAAATTGGAGCCTTTGCAGTAGAGG
AAGGCTGCTTAATTACATAACGAAACAAAAAAAAAAGAAGGTGTTTGCCTGTTGCCTCGA
ATTGTGAGGGAGGACGTACATATACGAACAAC
ATGGCTCGAAACATGCTCAACATTGCCA
AGT
GTAAGTGAAATAAAGTGAATCAGTTTGCCGATTTCTTCCCCTCCCCTTCACACCCTC
TGCTCTCTACTACACCCACGAGTTGCACAGTTGGACTTTGACCTTGGTCGACGTAGCGCG
AATGTTGTCAAGACGACTGGTTGGCTCTGCCTACTTGTTGCTAGAGTTGATTTACACAAT
CGGGCGTAATTGAGACATGCTCGTTGCTTACTTTCTCCGCAGATACTCGAACACTGCTCC
AGCGGCCACAACTTCGCCACTATTCCGAAGCCTCCGCACAGTTCCCGAAAATCACCACCC
ACTACACGATTCACCCGCGGGATAAGGATCCACGATGGGGAG
GTGAGTTGAGAAAATGGT
GCCTGCCACTTCGTTTTTCTTCACATCCCCCCCCCCTCTTTCTCTCCACAGAGGTCGACA
TGGAGCGTTTCGTCGACGAAGCGGATCTGCTCATCGTGGGCGGTGGTCCGGCCGGTCTCT
CCGCAGCGATCCGGGCAAAGCAGCTAGCGGCGGAGAAGGGCCAGGAGCTGCGCGTCTGTC
TCGTGGAGAAGGCGGCTGAGGTCGGTGGCCACATCCTGTCCGGCGCCTGTCTCGATCCGG
TCGCCCTGAACGAGCTGATCCCGGACTGGAAGGAAAAGGAAGCCCCACTCAACACGCCCG
TCACGCACGACAAGTTCTCCTACCTCACCGAGTCGGCCAAGCTGCCCATTCCGATCTTTC
CCGGCTGGCCGATGGACAACCGGGGCAACTACGTCGTGCGGTTGGGTCACGTCGTGGCCT
GGCTCGGCCAGCAGGCGGAAGAGCTCGGCGTGGAGATCTACCCCGGTACGGCCGCCTCGG
AGATACTGTACCACGAAGACGGCTCGGTGAAGGGCATCGCCACCGGCGACGTCGGCATCG
GGAAGGACGGTGCGCCGAAGGATACGTTCGCGCGCGGCATGGAACTGCACGCGAAGACGA
CCATCTTTGCGGAGGGTTGTCGGGGCCACCTGTCCAAGCAGGTGATGGCCCGCTTTGGGC
TGAACGCGGAGAACGACCCGCAAACGTACGGCATCGGGCTGAAGGAGGTGTGGGAGATCA
AGGCGGAAAACCATAAGCCGGGGCTGGTGGAGCACACGATCGGGTGGCCGCTGGACCGGC
ACACGTACGGCGGCTCGTTCCTGTACCATCTGAACGAACCGACGCCGCTGGTGGCGGTCG
GGTTCGTGGTGGGGCTGGACTACGTCAACCCGTACCTGAGCCCGTTCCAGGAGTTCCAGC
GGTTCAAGACGCACCCGAAGGTGCGCGGCACGTTCGAGGGCGGCAGCCGCATTGCGTACG
GTGCGCGGGCACTGAACGAGGGCGGCTTCCAGAGCATTCCGAAGCTGACGTTCCCGGGCG
GCTGTTTGGTGGGGTGCGGCGCCGGCTTCATGAACGTGCCGCGCGTCAAGGGCAGCCACT
ATGCGATGAAGAGTGGCATGCTGGCGGCGGAGAGTGCTTGCGAGGCAATCTTCTCCGGGG
CGACGCAGGAAAAGGCGGGCCTAGAACCGAAGGACTATCCCGATCG
GTAAGTGGGGGGGT
GGGGTAGATTTTGCGGTGCGTGCAACGCGGCTTTTAACATTTACGGTTTGTTTCAGCATC
AAGGAATCGTACGTGTGGAAGGATCTGTACAAGGTGCGAAACTCCCGGCCCAGCTTCCAC
ACCGGGCTCGGCCTGTTCGGCGGTGTGGCATACAGTGGTTTCAGCATTCTGGTCGGCGGG
CGGGAACCGTGGACGCTGCACCACGGTTCACCCGACCACACCCGCCTGAAGCCGGCAAAG
GACTGCAAACCGATCGAGTATCCGAAACCGGACGGCAAGCTGACGTTCGATCTGCTCTCC
TCGGTGGCGCTGACCGGCACCAACCACGAGGGCGACCAGCCGGCCCATCTGACGCTCAAG
GACGACACGGTGCCGGTGAAGAACAATCTAACGATTTACGACGGCCCGGAGGCACGCTTC
TGCCCGGCCGGCGTGTACGAGTACGTGGCGAACGACGAGGGCGGCAACATGAAGCTGCAG
ATCAACGCGCAGAACTGCATCCACTGCAAGACATGCGACATTAAGGACGTCACGCAGAAC
ATCAACTGGGTCGTGCCGGAGGGTGGCGGCGGCCCGGCCTACAACGGCATGTGA
GCGGGC
GGTTTTTGTTGCGGTCTTCCACGTCGCTGGGCGGACCTTCCGGTCGAATTTATTGTGTTA
AGAAGAATAAAGTTTCCCATTTGTAATTTGCGCA
CAGGCTTTCCACACATTACGGCACCC
ACGCCACGCGAACAGTGGAAGAAAAACAGTACCTCATGTATATCACACATTTTGTGAAAA
AGAAAAGGGAACGAGAAAAAAAGGCAAGCTATTTTAGAAAAATTGTTTTATAGTATATTC
ATACACGCGCAATAAAGGCAAAATTTACAATAAGCAACAAACAAAAAATGCAGATACTGA
TCAACAAAACAAACGAAAAAGAAAAACGGCAACGGTTTTTGATTCTTCTATGCTCGAATA
CGTGCACACAGGCGTGCGCGCGCAGCCTACTTGGACGCGTTGTGTCTTTTCTTGCTCGTC
TTGTGTCCCCGTAACCAATCGTTCTACTCCTCCTGGAGTGTGCTTTAGTAAACTCTCTTT
TTCATTATTTTCATAAACATTACCATAACTGAAAAGGAAGAGAGAGAGAAAAATAGTTAT
TTAAGTGAAAAGAATGTTCAATTAGTTTCACTGTGCCGAATCTACTTACATATGAATGTT
ATTATAACGAATACTATCATCAGCCACATCCAGCATTTGCAGGCTTTCTTTGAGTTTTCC
TGCAGCTTGGTGGATTCGGTTGTTAGCGACGATGTGTTTTGGTCAGTTAGCTTGGCAGAC
TTGGAAACGATCTGTAATAAAAATGGCAAATTAATTATTCCTTCTTAAAAAGCGGAAGCT
CCAGCTCCAGCTCCGTACCTCGGTGTCCTTCTTCAGGATCTTTCCGGCCGTTTCCGTCTG
TTCCTTTAAGTTTCTCGTTAACTGTGAGCGAAAGATAATGAAAAGACACAGCGTTAGCTT
ATCAACTCGCAGATAAAACACGCTCAACACGTCGACCCACCTTAAGCATATCTTCCGCCA
GCCGCTCCTGCTCGGTTGAGTATTGTTTCACGGTTTGTTCCAGATTTTCTGCCACCTTCT
GCCCCGCCCGCCGCCGTATCGTCGAAAAGTTCCCATTGAACAGCTCGCTGCGGAGCTCCT
TTTCGTACTTTTGGTCGTGAAACTGGCGCACCTCGCGCATCACATCGTCCCCGGCCGGAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004