login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG5703
Organism Drosophila melanogaster
Gene Name CG5703
Product NADH-ubiquinone oxidoreductase 24 kDa subunit (NUHM) (By similarity)
GENE MAP
Chromosome X
Citogenetic Map 16B10
Gene Map
Comment MTDROME05703 3180 bp DNA linear INV This record is derived from the following: AE003506 RH17835.5prime BI611516 gb|AY075322|AY075322 GH08937 full length cDNA. Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Transfer of elecrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Component of the flavoprotein-sulfur (FP) fragment of the enzyme.
Subcellular Location Mitochondrial matrix and cytoplasmic side of the mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
GO:0007399
Biological process: neurogenesis
SwissProt AC  --
FLYBASE FBgn0030853
View Sequence REFERENCE SEQUENCE
Scaffold AE003506
Sequence Location  --
Sequence Lenght 3180bp
Relative Gene location 749 .. 2174
CDS
CDS Location 1081 .. 2092
Sequence Lenght 242aa
Translation MLTNCASKTLAAVRANIRAIATSSARASDNLFVHRDTPEDNPNIPFEFTAENKKRVEAIL
SIYPEGHKRGAMIPLLDLAQRQYGWLPISAMHKVAEILQLPNMRVYEVATFYTMFMRKPT
GKYHIQVCTTTPCWLRGSDDILETCKKQLGIGVGDTTKDRKFTISEVECLGACVNAPMVA
INDDYYEDLTSKDMQDILNDLKADKISPPGPRNGRFASEPKGEPTSLSEEPKGPGFGLQA
GL
mRNA
mRNA Location 749 .. 2174
5'UTR Location 749..838,913..1080
3'UTR Location 2093..2174
Exon 749..838,913..1119,1249..1767,1922..2174
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATTGTTGAAAAGTGTCATAGATACTGAAGTCACAGCGATATATATCGCTTACTGTTTTAG
AAAACTTATTTTAAAAAGGAATAAAAAAAT
ATTTGTAGAGATTTGCTCATCTCTGACGAC
AAGTGCCAGTGTTGGCAAACGCTCCGCCGAAAATCAGCTGTAAGCGGTGCTTGTTAAAAA
AAAACTGACAGCAGCCGACGGACTTCACATAACATAAGAGCAAATTTTCAGCCTTTTCAT
TATTTTGGAAACGCCAGA
ATGCTGACAAACTGTGCCTCCAAAACACTGGCCGCCGTGCGC
GCCAACATCCGGGCAATTGCCACCAGCAGTGCCCGGGCCAGCGACAATCTGTTCGTCCAT
CGCGACACACCGGAGGATAATCCCAACATCCCGTTCGAGTTCACGGCGGAGAACAAGAAG
CGCGTGGAGGCCATACTCAGCATCTATCCGGAGGGGCACAAGCGCGGCGCCATGATCCCG
CTGCTTGATCTGGCACAGCGCCAGTACGGCTGGCTGCCAATCTCTGCCATGCACAAGGTG
GCCGAGATTCTCCAGTTGCCCAATATGCGCGTCTACGAGGTGGCCACTTTCTATACGATG
TTCATGCGCAAGCCCACTGGCAAGTATCACATCCAGGTGTGCACCACCACACCATGCTGG
CTCCGCGGATCGGACGACATCCTGGAGACCTGCAAGAAGCAGCTGGGCATCGGCGTCGGC
GACACCACCAAGGACAGGAAGTTCACCATCTCGGAGGTCGAGTGCTTGGGCGCCTGTGTC
AATGCGCCAATGGTGGCGATCAACGATGACTACTAT
GAGGATCTGACATCCAAGGACATG
CAGGACATCCTGAACGACCTGAAGGCGGATAAGATATCGCCCCCTGGGCCACGCAACGGA
CGCTTTGCCAGCGAGCCAAAGGGCGAGCCCACTTCCCTGAGCGAGGAGCCCAAGGGTCCT
GGCTTTGGTCTGCAGGCCGGTCTGTAG
AGGATGAGCAAGGAGCAGAACCTATCACTGATT
GTCGAACGAAAGTTAAATAAATGTTAAGCAACTTATAGAGGTCATTGAT
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
AAGGCTTGCTCTTTTCGGAATTCCTGGACTGAAATAGAAGCTACTTGAGAATCATTTAAA
TAACACAAATGAACTTATACTATCACATAGGGTAAAAAATATTAAACAAAATGTTTTTTA
TTGTTTATGATTATATAGCATTCAAATGGATTCCGTATTCAATAATACCTCATACAAAAT
CTTACCGATGCTGCGCGATTCGAGGATTGTGTTCTGCTGATTCTCTTGCTCGGCCAAATC
CTCCTGCAGCTTAATTTTGCGCTGGAACTCCTGCTCCTTGCGATGCACCGTGTAGTAGAG
GATGTCCTGCAGCCCGGCCATTTCGAGCAGCTCCTCAATTCGCGTGATCTGGAACATACA
GTCCTGTATCATGGTGTTGGCCTGTGCCATACCGGCACCGTTATCCTCCACTACCAAGGC
GCACTGCTTGACCAAGGTCAGGTCGAATAGCACCTGCTCCAAACGCGGCCCTACAACTGA
ACAAGCAGAAACATGTATGTATAAATCTTACTTGGAGATTCGCGCATTATGCCCACTCAC
TCTGCTCCTCGACGATCAATTCTTTCCTTTTCTTGAGTTCCTTCTCGAGCTGCGCCATTT
TGGTATCTTTTGGCCAATTTTGCCCCATAAATTCTTTGACAAGTGGATATTTTTCCATAT
TTTGTCCGTTCAATGTTTCCCCCCGATAAGCTTACAAGTTTGCGCGTTCAGTAATTTATC
GGATATCGAATGCTAAGGCACAGCGATCATTGTTGAAAAGTGTCATAGATACTGAAGTCA
CAGCGATATATATCGCTTACTGTTTTAGAAAACTTATTTTAAAAAGGAATAAAAAAAT
GT
AACGTACCGCTGAATATTAATTTAATTACAAGTTTTATTTGTTTAAGCTTTTTTTTATTA
ATGTTGTACAAGATTTGTAGAGATTTGCTCATCTCTGACGACAAGTGCCAGTGTTGGCAA
ACGCTCCGCCGAAAATCAGCTGTAAGCGGTGCTTGTTAAAAAAAAACTGACAGCAGCCGA
CGGACTTCACATAACATAAGAGCAAATTTTCAGCCTTTTCATTATTTTGGAAACGCCAGA
ATGCTGACAAACTGTGCCTCCAAAACACTGGCCGCCGTGGTGAGTAGCGCAGCCATCCAA
ACTGTCCAGTAATTCGCGGTGTCAACCAGGGAAGGCAACCTGTTCCCCGAGTTATATAAT
TGGCGACAGGAAAACAATAACATTAAGGATATGTGTTGTTATTTGCAGCGCGCCAACATC
CGGGCAATTGCCACCAGCAGTGCCCGGGCCAGCGACAATCTGTTCGTCCATCGCGACACA
CCGGAGGATAATCCCAACATCCCGTTCGAGTTCACGGCGGAGAACAAGAAGCGCGTGGAG
GCCATACTCAGCATCTATCCGGAGGGGCACAAGCGCGGCGCCATGATCCCGCTGCTTGAT
CTGGCACAGCGCCAGTACGGCTGGCTGCCAATCTCTGCCATGCACAAGGTGGCCGAGATT
CTCCAGTTGCCCAATATGCGCGTCTACGAGGTGGCCACTTTCTATACGATGTTCATGCGC
AAGCCCACTGGCAAGTATCACATCCAGGTGTGCACCACCACACCATGCTGGCTCCGCGGA
TCGGACGACATCCTGGAGACCTGCAAGAAGCAGCTGGGCATCGGCGTCGGCGACACCACC
AAGGACAGGAAGTTCACCATCTCGGAGGTCGAGTGCTTGGGCGCCTGTGTCAATGCGCCA
ATGGTGGCGATCAACGATGACTACTAT
GTAAGCAATTCTAATTGCTAAATGTGTTTCCTG
GTCATTTGTTTGTAGGAAACGCCAGTTTCACTCTCAGCCTCGTCCAGCGTTTCAATCTTA
ATGCGCTGAAATCGACTCTATATTGTGCAAACATTGCTAACGTTTTTTTTTTACTTTGCA
GGAGGATCTGACATCCAAGGACATGCAGGACATCCTGAACGACCTGAAGGCGGATAAGAT
ATCGCCCCCTGGGCCACGCAACGGACGCTTTGCCAGCGAGCCAAAGGGCGAGCCCACTTC
CCTGAGCGAGGAGCCCAAGGGTCCTGGCTTTGGTCTGCAGGCCGGTCTGTAG
AGGATGAG
CAAGGAGCAGAACCTATCACTGATTGTCGAACGAAAGTTAAATAAATGTTAAGCAACTTA
TAGAGGTCATTGAT
AAAGGATTTTTGGATTTTTTTTTAAAAATATGCTCACTTTCCATTG
GAAAGTTTCCATTTTGAAAGGTTACACATAAAATAATAACTCCCAACGAACTCGAGAATA
CTAGTACATTCAATTAGATGTGGAAGATCGCCAGAACCCCAATGCAAGCCAAATGTGCGT
TTTTCATATCTTGACCAATAAATGATTTTATTTTGTAGTGGAAACGGCAGGTTCCCATTG
CTAATTATAATGGATGTTTACTATTGCATACGTACGCATGTTCCATTACTAATTATAATG
TTCGCTCATTATAATTGTATGTACAATGGCGTACGTACGTAAGAACGAATATTATGAATT
AAGATGATTGGAAGAGTAGTTGAGAGGCTATTTTCAGCTGTGGCAATTGACCAATACAAA
CATCAATTACTCAAAGGATAAAACTAAAGCTACAGAAATGATGCCTTACATTCTACGCTG
GTTGAGTGCAATTAACCAGATATAATACTACATGTATGTACGCACTGTGATGCAGTCGAT
TGCCTGTCCTTTTTACTTATGTACTAAAATCCGAATTTAATATTTAGTTATTTGTGTTGC
CCGTAAAGTTGTCCGCCAATAGTCAGGATTGTGGACATGATGTGGATTGGCTCCGCCCGC
GAGCTTTTTTAAAACCAATAACGATAAGGGAAATTTTCCGTTAAAATCTAACTGGAGCCG
CCATGGGTCACCTTTCCGCGTACTTCGGTCCGCATGTGTTGTAATATTATATGTAAAAAA
AAAAAAGTGTACTAAATTCCTACATGGATTTCCTTCCTTGTTGCCCTTCCTCACTCCTCG
CCGTAGAAAATGCTGAAAGTATAAAGGTTTATTGACATATGAGTAACATGGTTGAGTGTG
GATATCAAAACTATAAACAAAATAATGAAGAAATCAGACACAATGCGTGAAATTAAGCAA
CGAAACGGGCAAATATAAACTGAAAGTATCAACTGAGGAATAACTGAATTTAATACTTCA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004