login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG13263
Organism Drosophila melanogaster
Gene Name Cyt-c-d (CG13263)
Product Cytochrome c (CYC) (By similarity)
GENE MAP
Chromosome 2L
Citogenetic Map 36A11
Gene Map
Comment This record is derived from the following: AE003652 AT20632.5prime BF486357 [Cyt-c-d] AT01001.3prime BF492468 [Cyt-c-d] RH17228.complete AY071701 [Cyt-c-p] Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers thiselectron to the cytochrome oxidase complex, th
Subcellular Location Mitochondrial matrix
EC Number  --
Functional class Oxidative phosphorilation; Others
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0006917
Biological process: induction of apoptosis.
SwissProt AC  --
FLYBASE FBgn0000408
View Sequence REFERENCE SEQUENCE
Scaffold AE003652
Sequence Location  --
Sequence Lenght 8760bp
Relative Gene location 981 .. 4758
P-insertion P{EP}Cyt-c-d-EP2305
P{EP}Cyt-c-d-EP2049
P{PZ}bln-1
CDS
CDS Location 4258 .. 4575
Sequence Lenght 105aa
Translation MGSGDAENGKKIFVQKCAQCHTYEVGGKHKVGPNLGGVVGRKCGTAAGYKYTDANIKKGV
TWTEGNLDEYLKDPKKYIPGTKMVFAGLKKAEERADLIAFLKSNK
mRNA
mRNA Location 981 .. 4758
5'UTR Location 981..1340,4249..4257
3'UTR Location 4576..4758
Exon 981..1340,4249..4758
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GAAACGCTCTAGAAATTTCAGTAGTGGTAAAGGCCAGAACACATAACTTTCGAAGGTGAC
AAGCAGCAAACAAATTTTCCGTTCTCGCCGAGTCTTGTTGTTTTGGGGATATTTTCCAAC
TCAAAAACTGGTGCGTTTCAGTTCCTTTACAGACGCAAGACGCGTAATATTCGATCGGTG
TAACGGTGAACAGAATCGGCAGCGGGAAAACCGAACGCGGCGAACTCAGCTGATTGAATG
AAAACGCCAAGCTGAGCAGCAGCCACAATTGCCATTGCCCCAACCAGCGCTCATTGAGAG
AGGGAGCCAACGAGAGAGCGAGCAACAAGCAACTGCAGAGCGAGAAGAACTGTCCGTCGG
GCTTCCAAGATGGGTTCTGGTGATGCAGAGAACGGCAAGAAGATATTTGTGCAGAAGTGC
GCCCAGTGCCACACCTACGAAGTGGGCGGCAAACACAAGGTGGGCCCAAATCTTGGCGGG
GTCGTGGGTCGCAAGTGTGGCACAGCAGCGGGATACAAGTATACCGATGCCAATATAAAG
AAGGGCGTTACCTGGACAGAGGGGAATTTGGACGAGTACCTCAAGGACCCGAAGAAATAC
ATTCCCGGAACAAAGATGGTGTTCGCAGGTCTTAAAAAGGCTGAGGAGCGGGCCGATTTG
ATTGCCTTCCTCAAGTCAAACAAGTAG
AATCGCCTGCGAAACAACAAGATCGGCCACCAT
GCTATCCAGAAAACTGCGCTTAAAGACTACAAACATATTCAAAAGATGACGTATTTCACT
TGGATTTCGAAACTTTGATTGGGAATGGTCGAGCTCAAATACATTTCAAAAAGGTTTACT
TTCACTTTAGCCAATTAAAGTTGATAAACC
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GTTCGCATGAGATCCACTTTCAAAGTTCCCAGGAAAGGCTATGTTCAACCATCGGGATGA
AAAACTTTGGCCAACTTTTACTTTAAAAGAACTGGCCAATGTTGTGAAGTTCAATCGAGA
AGGTAATTTCCTTTGAATAAACTTTTTAGAAGTAAAACGAAATACAAAGGTTTTAGGAAG
AAGTTTCTCATAAAACTTTAAATAACATACTAAAAGAAATACATCAAATTATCTTCCATA
TTAATTAAATTGGGGAGCCCTTGATACATGAGTAGAAAATAAACCAGGTGTATTTTATCA
AAAGTTTTTGAATTGAATAACTAAGAAAACGCAGAATTCGCCACTTTACCTTTCTAAAAT
ATTAATATGTGCGTTTTAATTATGTGAAATCACAATTCAATGGTTAATCAAATTCGCATT
AAATAAGTAAAGCAATAGATTATCCTTTCGAGTTGAGAACCCCATTCCCTTCATATGCGA
ATGTCCTTCGGCGATAAAAAAAAAAGGCAAGAGCCTTATAGGATAATCTGGTTTTTAGCA
GGAACTACATATATAAGTCGCAAAGGTCTCGCTCATATCGGAATTTATAAAGGAAATGTA
AAAGAATTTGGGGTTGAAATAGAAGTGGGGGCAGGCCATAAAACCAAATGAAAAACGAGT
TGGGGCTTACGTTCGAACGGAAACGCAAATAAAAAACAACAACGTTTTGGCGTGATTACG
TAAAATGCGTAAAAGAACAGAAAGAGAGAGTAAATCGACGATGAGAAAGAGAGACTCGCA
GGAACCACTTGACGCATTTCAAGGACACGTGCAGCCTTTGCAAGGACACACGCAGCACAA
AAGAGTGGCGAATTACACAACACTGGGTGTCGGTAGCGCTCCCACCAACTTACCGTAATA
TGCAAGTTGGCAGCTCCTTTCTGGTGGCTGCCCTGTAGCTTTCTTGCCTTTTTTTGGATT
CAGCTAGGTAGGCCCTGACCGAAACGCTCTAGAAATTTCAGTAGTGGTAAAGGCCAGAAC
ACATAACTTTCGAAGGTGACAAGCAGCAAACAAATTTTCCGTTCTCGCCGAGTCTTGTTG
TTTTGGGGATATTTTCCAACTCAAAAACTGGTGCGTTTCAGTTCCTTTACAGACGCAAGA
CGCGTAATATTCGATCGGTGTAACGGTGAACAGAATCGGCAGCGGGAAAACCGAACGCGG
CGAACTCAGCTGATTGAATGAAAACGCCAAGCTGAGCAGCAGCCACAATTGCCATTGCCC
CAACCAGCGCTCATTGAGAGAGGGAGCCAACGAGAGAGCGAGCAACAAGCAACTGCAGAG
CGAGAAGAACTGTCCGTCGG
GTAAGCTTGTTGCGTTGTTGCTGCCCCTTACACAGCAAAA
AAGAACTTAGCTAGTTTTACAATTGCTTAATTTTATATGAAACTAAGCATATAGTCATAT
TTGTTTATTAAACTAAATAAGTAGCTATATTAAAAAAGCTAATTATTGGCATTCTCCTTC
TTTTCTCCCACTGTGCACGATGCAGAGACGTCAGCAGTGCACTCAGAGCAAAGAACAGGT
ATAAAATGCCCAAAAAGAAGCATTTTTAGTAATTTTTCATTCACACATTTCCAACATTGC
TCTCACGCGCAGCGCTGCAGCTCTCTCGCAGCGCTTTCTCCGTGTCATTTATGTTGGAGC
TGCTCTCTTTCTAGTCTCTCTGCCCCACTCTTTCACCTCTTTCTCTCTCTCTCGCTCAGC
ATAAAATGCAAAACCAACTAGCGGTGTTGTTGTTGTAGTTGGGGGGTTATGTAACTTTCG
GGCATCCGCAAGCACAGAAAGCTGAAAGCGTTGAAGGGCAGTCAGCGACCTCGTTCTAGA
AAAGAAGCCATCTCTTCAGCCCCTCCACGCACCACCCCTCAAAAGAAAGCCCCCCCCCAA
AGAAGAAGAAGCAACAGCAGTGAAAAGCGCGTAGTATAAACACATGCTGTAACATAAACA
GTGGTACTTGCTTAACTAAAGCAACTATGCTTGCACATATAATTATAATTAACTAAATGT
ATTTGCTACCATTATCTTTAATGTAAAGTTTTGACAATGTGTTTTTCCTTAAATATCCAT
ATTAAGCTCACTAATATTTCATAAAAACTTTTCTTTAATCTAAATATTTGACATCATGTC
ATATAAGTATTACTGTGCAATCAAAAAGAAAGGGGAGCAAGAAAGAAATGTAGGTTTTCT
GCCATGCAGGGCAGGGGCAAACCAGAAATGTCTGCTTTTTAGGTTGGGGAGGTGGTTCTT
TATGGGTATAGCTTTCGAGGGGGTGTGGCCTGGCGGGAATCCCAAAGTCATGCCAAATTG
CGCAACAGCCAAAGCGTTGTTCTTGGTAACCCGCTGACCGAGGATATTGACGCAGAAGTG
GGTATGGAGTGGCAATAATAATAATTTCACTGGTCAAGTCTGAGGTACTCCAAGAAACCG
TTATTAAATTATGTTAAGTGAACTTTCCATGGTTACAACAAAAAAAAACGAAAGAGAACA
ACAGTATAGTCGATTTCCATGACTATACACCCAGCTAGAGGTAGTGCTAGGAAGATTTTA
TAGTTTTTGGCATATCGATAGAATCTTTTTAAAAAAAAAAACGTTAAATCATAGTTTTTG
GCGTGACACCTTTGCAGTCTTCTGAAAGAAAGCTGCGTATCGTACATACGGACAAATAGA
CGGACAGCAGACATTGTCAGATCGGCTGGTGATCCTAATTAAGAATATACTCTATAGGGT
CGGAACCGTTTTTTCCCTCTTACATACTTTACGAAAGTAGCGGGTGGAGCTACATAAAAC
ATTTTTCCCTTCCTCATTACATTTGAGCAGATGCCGCAATATGCTTTTTATTTTTGCATA
ACAATTTCCGCACCTTACAGGCAATTCAATATCTGCACCTCCTTTAGCACGCAGACTCCT
TTGTGCCTTTGCACTCTTTTTGAACTCTATTTGTCCTGGACCATCCTCTCACCTTTTTAT
GGACTTCCGCAGCAATAGATCTAGTAAACAATATAGCCTCCCCACAACCTTTCCGCAGGC
TATCTCTTTCCTACTACTACCCCATGTTCGGCCGAGCCCGTTCAAGCGTAATTTAATTTC
TTGCACCATTTATTTATAGTGGTCCGGCAAAAGAACTCGGGCCAACAGGCAGGATAGTTT
AGCCTGCGGGTAAATTATGGTTCCATTGCCAATTAGGTTAGGTCACAACCAGGATGTCCC
ATTGGGGATATATGTATGTATGTATGTAGATGGATGCACAGGGAGTACACCTAATACCAG
TGCAGGGCTGCCAGGAAAATGTCATTGTTTGGATTTAGAATGTGACATTTACATACGTAC
GTAATATAAATATATAAATAATATCATTCTCTGAAAAATATCATAATGCACTCTTGTAAA
TTTAAAACAAATTTAATTTTAAGATAATTGGTTGAGATAAACATAGTTAATATTTTCAAT
TGATCCTTTAAATTTTAAATTGCAGGTGAATATCATCCCTGTGTGACCGTTGTATGCGGC
ATGGTTCCATGTCTCTTTCCCGTTATTCATTTCCCTCTGCTTTGTTTTTTTTTTTTTTGG
TTTTGTTATGCGGTGGCATCTGTTTTTGCCACAGGAAAATGGTTGAGAGAGGGGAAGGCA
GGGGGCGAAAGCGGAGAGTGCGTAAAATGCGTTTTAATTGAAAGGAAATGTTCAAAGCAC
ATGTGCATCTGCTAGTCAACGAATTGGTTGGGAAAGGGGGTGGCAAGCCGAATGTGTCTG
CTAATTGAATTACCTTTCGGTTGCTTTTCCCATTAGAAGTGCCGACAAGTTCTCGAGCTG
CTTGTTTGCTTTTCATTTAATACCCATTTTGATTTAATTTTCGTTTTTCCTATTTTTCTG
ACCCAATTTTGTTTTGCTTTCGTGCATTAGCAGCTGTCTCTGTCTATCGCTGTGCAGCCA
AGAGAGTGACCAAGAGAAACGCTCTCTCTCTCTCTCTCAGTTGTCCAGGACTTGCACTTT
TCAAACGGTTTTTTAGGACACTGAAACAAATTGAATCTGTTTTTCTTTTCTATCAAATTT
TTAGTTCTACACTTTTCTTTTTCATGATAGTTTCGGAATCAACCAATTTCTATTTGATCC
AAATTAACAAAAAACAAATAACAAAAAATTAAAAAATATAGAAATAAAAGCTGCATAAAA
AGTTGAATTCTAAATCATAAATATCATTTTTCCCTATTTGTCTTTCAGGCTTCCAAGATG
GGTTCTGGTGATGCAGAGAACGGCAAGAAGATATTTGTGCAGAAGTGCGCCCAGTGCCAC
ACCTACGAAGTGGGCGGCAAACACAAGGTGGGCCCAAATCTTGGCGGGGTCGTGGGTCGC
AAGTGTGGCACAGCAGCGGGATACAAGTATACCGATGCCAATATAAAGAAGGGCGTTACC
TGGACAGAGGGGAATTTGGACGAGTACCTCAAGGACCCGAAGAAATACATTCCCGGAACA
AAGATGGTGTTCGCAGGTCTTAAAAAGGCTGAGGAGCGGGCCGATTTGATTGCCTTCCTC
AAGTCAAACAAGTAG
AATCGCCTGCGAAACAACAAGATCGGCCACCATGCTATCCAGAAA
ACTGCGCTTAAAGACTACAAACATATTCAAAAGATGACGTATTTCACTTGGATTTCGAAA
CTTTGATTGGGAATGGTCGAGCTCAAATACATTTCAAAAAGGTTTACTTTCACTTTAGCC
AATTAAAGTTGATAAACC
AAAAACCCTCTTCTTAATTCAAGTTGTGTGCGACGCGGGTGG
AGGAAAGTGTTGTACCAATCAGCTTTGGTCACAGTTGGTTTTATGGTCCTACTAGCAAAA
TGTAATAAATTGGAGAAGCTTGTTAAATAATGCAAATTTTCCAGAGGCTTTCCAATATAG
TCCCGTTAATAGGGGAAAAAATTACTTATACGCCGTGTGGTGGATAAATACGGGTACAAA
AGCTTGCGACATTTTTTAATGCGTGGCCCCCGGTCACTCTGGTCACACTAATTACCTATC
GACATAACGCGCGCTCGTCATTCGTGAAAAATCGGCGACGCTCGACGTTTGTGTTCAATG
TAAGTAGTGGGTGGAATTTTTGTATTTTCAAGTGACGTAAATATTACCTTGAATAGTTAT
TGATTATCAAGCCCCAAGTCAGATAAAGATTAGAAACACTTCCGTGTCATTTACGTAACA
TCCAGCAGCTGTGTTTTGTTCTGAAAATGATTCGCATGCAAATTTAACGTATTCTTTGGG
GGATGATTCAGGTTACATAAACGTGTCCTTGTGTGTGTGTGTATAAGTGTGATTTTTTAT
TAGATATTTAATAGTTTATTTAGCAAATATTAGCAGTGGTGTATTAATAGTAAAAATAGC
ATCCCAAAGTCACATTGCCATTGAAAAAAGCCCCGGAGAGAGTCGATTACATGAGCAAAG
AGAGTGGCGTACCCGATCATCAGCTGTCTCGCTCGCTCAGTGGCAAAAATTAATTCTTGG
ATTTTTTGTCAATGCTTCAGCTTTGGAGTCTTTAAGCGCGCCACGTGGTTGCTAAGCAGG
TTTTGCTTTCTGCGATGTGCAGTTTTCTATAATATAAATAAAAGAGAATTCACCTCTGCG
AAAAGGCGGCTTATGTAACATTCGCTGCTCTCAGGAAACTTGGATGTTGGCCCAATTTTC
ACTCATCTCTTTGTTCTCACCACCTTGCTCACCCACACAAGGAAAAACACAGCTGCCTTT
GGCCTGCTTCCAATTTTCCAATTGCACTTTCCCTTCATCTCACGCACACTCACGCACGGC
AATTAACTGAAAAATACTCAACAAGGCCAAATCGGATGTTGACATTGTTGTTGCTTTGCC
ACCTCTCACTGCCAAAGTGCATGATACTCTACACAGAAAGAAGTGAAAAAAAGGTTGATA
TTAAATGCAAATTATGTGTAAAAGCGCACAAAATCAATAGTCTATATATATTAGGTTTGT
TTTTATAGACAAATGCATATAAAATAAAATTAGTTTTCTAGAATTGAAAGAGCTTCAGCT
AATCGAATTTCTCTCAGTCTATGTGCGTGATGTGTAGGTGAATTACTCACCGCAACGGTA
CTTTGCACTCTCAAGTTCAAATTGCTGCATGCAATTTATAATCCGGCAATTAGCAGGATG
ACCGTAACACAGACCCTGGAATAATAGAATAGTTATGTAAACAACTAACGTTTTTCGTAT
TATGATGCTTCCTGGAAGTTTTCCGCCTGTTGCTGAGCAGTTCTGACGCAATTAATCGGC
GACTGGCAAATATAAGCGAGTGAGACACAAAGAGAGTGTGAGAAGGAGAGAAAGAGTGTG
GGGGCAACATGTGACCAGCGTCTGAAGCTTTTTCAAAGTGTGTTTCTGATGACGTTGCGA
CGCCCTCCACGCGCGTATTAGTGAGAGCAAAGTATGTGGGTTAAAAAGGGGGTGGCCGCA
AATGGAAATGCAGACTACGTTAGATAATAATTTCGGGCCTTATCAGAAACAACAGCCGAC
TAATGCACTTAGCATGAGCAATTTTAATAATTCCGTTTCCGCAGGGAGCTTATCAATTGT
TTACATAACGGGGCAAGGGGACAAATATTAATTCACGGTCCATAACTACCTACATTAACC
CATTATTTCCCAAGCATGGAAATTTTTGATGATATAAAGACGTTATTATTTTAATACCTT
AAAAATATATAATATTATATAAGTAACGTTGGGAAATCAACTGGTTAATAAATTTTAAAT
TTCGGGTTTATTTATTCAATAATCTTTTGATAATGTATGGCTGAAAGTGAAGCTTTTATC
AGTATCTACACAATGGTTCATTGGGGCTAATAATAAATGGTATCAAATATCGTATAACTA
TTTTTTGCAGTGAAACCAGAATTTCGGACTAAGTACATAAGCAAATGATATAAAATATAT
ATTGTAATCAATTTATCAGAATAGAACAAATTAATTGGTAGCAGTTATGAACTTTGAACC
ATTTAGTAGCCAGTTTTTTAAGTTTTTCAAACCTAAGATGTAAGATAACAGATATATTGG
TTACCCTTGTTTTATGAACCACTCATTAATAACAAACATTTCTTTTTACAGTCGAGTCCG
TGTTAACACATTAATTAACCACATAATCCATAATGGGCGTTCCTGCTGGTGATGTTGAGA
AGGGAAAGAAGCTGTTCGTGCAGCGCTGCGCCCAGTGCCACACCGTTGAGGCTGGTGGCA
AGCACAAGGTTGGACCCAATCTGCATGGTCTGATCGGTCGCAAGACCGGACAGGCGGCCG
GATTCGCGTACACGGACGCCAACAAGGCCAAGGGCATCACCTGGAACGAGGACACCCTGT
TCGAGTACCTGGAGAACCCCAAGAAGTACATCCCCGGCACCAAGATGATCTTCGCCGGTC
TGAAGAAGCCCAACGAGCGCGGCGATCTGATCGCCTACCTGAAGTCGGCGACCAAGTAAT
GGTGCTGTCCATCAACTTACCCACAACCACTGCAGGATGTCAAACTGTATTATTGTGTTC
AGTCACAGTCCGGCACGCAAATGCAGCAGCAGCAACAACTACAACTACAAATCAACATAG
TACAGACCTAAAGAACTACAATTATGTTAATTATAAAGTTTAAATAGGACAATTTATTAT
TTAATTTAAATAAAAAGTGGAATATTTAATTCAAACCCGATGAGAATTGTGACATCCACA
AAAAAGTTAAATAATAAAAAAAGAACTAAAAAATGATATAAAATCTGTTTTATGCGAGGA
CCTGGTTTTTGTAGCTCGCAGGTCAAAAAGAATAAAAAAAGCTTCTTCAGATTTTTGACT
CGGGCAACTCAAATTAAAAATAAGAGATACCAATCATATTTATAAAACAATTGTCCTGGC
AATTTCTATCAATAGGTATCTGTTAGTCGTCAAACTCGACTGCAGCATACTCTTTGCGTC
TGTCAAAAATGTTGTTGGCTGATCTATATAGGCCTTACTCATCTGAGTCGCACAAAGATG
ACCACAAATCATCCTGGGTTGCTGCAAATTCCTTAGTTCATTGCGTGGAGGTAGACATCA
CTAAAAACATCCAACAAAGAAAGAGTCGATACGTTACGCAGAAACATCACAATAAGATTG
TATTACTGAGAGAGAAAGTAGAAAACTATTAGGGTCGAAATGCTCTCTTAATGCACATTC
TATTTGGCCAATCGTTAAACAAGAATACACTGGTATTTTTATATTTTTTGGCTAATTTAT
GTATATTTTCTTTTACACTCCCAAAATTGTATCATACATTTTAATAACAACTTTATTATG
CAATACATATTTTTCGTTTTAATTATGCTTATTTGATTTATTTTTTTTTTAATGAAAGAA
ATACTTGATAGGTTTATACAATATATTTTTTGTTTTCTTTAGTTTCGTTTTTTGCTTAGA
TGTGGATGCGCAGATGCGACTATATAAACGTAAGAAGCGCATATCATCTGGTTTAGAAAA
ACTCTGTACAGCGGCGCACTCATAAAATTAAGAACACAAATAATAATAACAACAAAATAT
ATAAACAATCGAATTGAATGGAACAATTTGTAGAGGATAGTTGCTTGTATTTGTTCTGCC
ATTACAGTGAATTGCTTTTTGGAATGCCAACAAAAAATCGAATTTTTCTCTCAATACTTT
CTAAGAACTGAGGGCGTACACGGAGGTATGGGCTAACAAAAACTTAGTTTAAACGGGGAA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004