login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG13263
Organism Drosophila pseudoobscura
Gene Name Dpse\CG13263
Product Cytochrome c (CYC) (By similarity)
GENE MAP
Chromosome pseudo4-mel2L
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig1006_Contig943 The following contributed to sequence development: bases 1..5940 = Contig1006_Contig943 818700..812761
PRODUCT
Function Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers thiselectron to the cytochrome oxidase complex, th
Subcellular Location Mitochondrial matrix
EC Number  --
Functional class Oxidative phosphorilation; Others
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0006917
Biological process: induction of apoptosis.
SwissProt AC  --
View Sequence REFERENCE SEQUENCE
Contig Contig1006_Contig943
Sequence Location 818700..812761
Sequence Lenght 5940bp
Relative Gene location 1020 .. 1337
CDS
CDS Location 1020 .. 1337
Sequence Lenght 105aa
Translation MGGGDADNGKKIFVQKCAQCHTVESGGKHKVGPNLSGIVGRKSGSAPGFKYTDANQKKGV
VWSDSTLDEYLKDPKKYIPGTKMVFAGLKKAEDRADLIAYLKKNK
mRNA
mRNA Location 1020 .. 1337
5'UTR Location  --
3'UTR Location  --
Exon 1020..1337
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGGGGGGCGGTGATGCAGACAACGGCAAGAAGATTTTTGTGCAGAAGTGCGCCCAGTGC
CACACCGTCGAATCGGGAGGCAAGCACAAGGTTGGCCCCAATCTAAGCGGCATTGTGGGA
CGCAAATCCGGCTCTGCTCCGGGCTTCAAATACACAGATGCTAATCAAAAGAAGGGCGTT
GTTTGGAGCGATTCGACGCTGGACGAGTACCTCAAGGATCCAAAGAAATACATACCCGGC
ACTAAGATGGTTTTCGCAGGACTCAAAAAGGCCGAAGACCGTGCCGATTTGATTGCATAC
CTTAAAAAAAATAAGTAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TGAAAGCGCTTGGGGGGGAAAGGGTATCAAACGCCTCGGAGTGCCGAAGTTACCCTGCCA
TTCTTTGAAAGGCATGTGTTTTTGCCACCGCATTGTATCGAGAGGGAGAGCAGGAAGATG
AAGAACATGCGTAAAATGCGTTTTAATTGAAAGGAAATGTTCAAAGCACATGTGCAGCTG
CTGCGATGGGGTGGAGTGGGGAGGGGAGAGGAGGGATGCTGCACTGCTAATTGAATTACC
TTTCGTTTACTTTTCCCGTTAGAAATGCCGCCTAGCTCTCGAGCTGTGTGCATGTGTGTG
GCTCTTTGCTTTGCTTTTCATTTAATATCAATTTTTATTCATTTTTGTTGTCTTCTTTCT
CTGCTCCTCCTGACCCAATTTCGTTTCGCTTTGTACATTTGCAGCTGTCTCCGTCTAGCC
CCTGTGCAGCTAAGAGAGCGCGTCAGAGCGCAGTCCACTGCCAGTGCCGCTGCCAGTGTT
TTTTATTTTTTTAAGGTGAAGCACTCACGCTCATGCTCTGGCTTTTCTCAGCGAGTCTTA
ACATAGGCGATTATTGTAAGAGCGAATTCTAGCAATACCTCACCTTATACTAAAACACTT
TTTCAGATGACGCTGTCGCTGTGTCGCTGTTTCTCTCTCTTTCGCAGTTGTCATCAACTG
GCATTTTCAATCATATAAATCATACAAAATTTGGTAACAGGAATTGTTTTCACTAGATTT
TGGCTTAGCTAAAAGGTTTTTTCTGGTGGGTTGGACTTTCAAATGGTTGTGTCACGACAA
TATACTGCAGTTGGACACGTACATACATACATATGTACATATGTATATGTATATATTTGT
GATGTGCCCACGCATGCCCCCAGCTTCACGCATCCGAACAGACCCTTTCACTTATTAACG
GAAGTGTCCTTGAGTGGGGGCCATGTGCGGTGAAGGCAATGATGGCATGGGCTTAGAGGA
CATCCCCACCCACACCACTCTAAACCGTTTCCACTTTCTCTTTCTTGCAGTGATCCACGA
TGGGGGGCGGTGATGCAGACAACGGCAAGAAGATTTTTGTGCAGAAGTGCGCCCAGTGCC
ACACCGTCGAATCGGGAGGCAAGCACAAGGTTGGCCCCAATCTAAGCGGCATTGTGGGAC
GCAAATCCGGCTCTGCTCCGGGCTTCAAATACACAGATGCTAATCAAAAGAAGGGCGTTG
TTTGGAGCGATTCGACGCTGGACGAGTACCTCAAGGATCCAAAGAAATACATACCCGGCA
CTAAGATGGTTTTCGCAGGACTCAAAAAGGCCGAAGACCGTGCCGATTTGATTGCATACC
TTAAAAAAAATAAGTAA
AACATTTCGAAACAACAACTACACATACACTAACACTATCCCT
ACGTTAATACCAAGAATATAAATATATACACACACCTGTGTCAAAAGTAGCTCATTTGAC
CAACACAATACAAACGTTAATGCCAAGAATATAAATGTATACACACCTACTTCAATTAGT
TAACCCGCCCTACATGAAAATAACTGTCCAAATATCACAACACAACACAAATGTTATACG
CTGATTAACTGATTCAATTATACACCACACTACACTGATATAATGATATATGGAGAGGAA
ATGGTTTCCGCAAAAAGTGAAACCGCCTTACATATAATCATTTAAATAATACATTGAGAT
AAAATAACTGTCCAAATATCATAGGCTTACCGAATTAGCACACAGAATCAGAAATTGTAT
ACGCTGATTAACTGATTCTACACTACACTACACTGATATAATGATATATGTATACAGAGA
AAATGGTTCCCAACCAGCCCTAAATCTTATGATGTAATGTTAACAATATACACACAGATA
AAAAACATACACTTACAGACTTATACTATATACAAAAAAATGATTGTTAAACGTTTTATT
AAACTGCAAGAAAATGTAAAAAAAAGATAAGCAGAAGCTATTTTATTTCAAATGCGCGGC
TAACAGGGCTGTGTGATATTTTTGTAGCAGTGAGCATCTTAGCGCAAAAGTATCGAGTGA
AGATGGTATCGTATATGGATGGACAGTATATCCCTCAACATGGCGCGGATCTGCATACCC
TAGAAATGGATATTATAGAACTAATAGAATGTTTGTCATATGAGGCTCCAAGATATGCAG
AAACTAGTCAGTCTCTGTTTTAAAGCTTTCACAACGATATTTTGAATATGACCAAGAATA
TGTATCGGGATCGAGATATATATACAAGCCACTAAACATATGCATTATGAATGTTTTTAA
TAATTATATTTACGAAATATGGTATAGAAGCGCACATACTCACTTACGTTTCCACTGTTT
TTTGTTGGCTTGTTTTGTTCAAACCTTGTTTTAAACAGAATACAATAAAAAAAAGTACTT
AAAAGTTGCTTATTTTGTAGAAAATGTATTCATCAATGGGATAAATTTATGTAGTCAGAG
CAAAATGTGCTATCTAGCTAGTAATAGTAAACCGAACATGAAAATCGAGGAATATGGTTT
TCGATCATGGGCAGAGAACGATTAACCCATTGTAGACCAATGGAAAAATCCACTCCTCGA
AAATTATGAAACTTGAACAATTTTAGTGCAGTTCAAGTGAAATACATAGTGGAAATGTTG
ATTGTAGAGAAAAAGGAAGGATTAATCTACGAGAATAATTCACAAACAGTTTTTTCCGCG
GCTTAACTCAGGTTTTTAACATTTTTAAATAGAGGGGGGTTGAGTGGGTTAAGTTTATTC
AATCGAATTGAATCGAAACGCGAATATTCACGGACTATTCATTCGCAAAATAACTGTCCG
CAGCAACGGTTTGTGTTCAATGTAAGTAGTGGGTGTTTTTAATAAAAAATTAAAGTGACG
TAAATATTAGCCAGCGCTATACAATGACAAGGTCTCAAGACAGATAATAACGGAAAATTT
GTAACTTCCGCATGGCTCTTGCATAATTTACAGCTGTACAAACGAATTGAATAGATTCGA
TTCGCAAGCGAATAATTTCATTTTTTTGGGGGTTGATTCGGTGGTTACATAAACTAGTCC
TTGTGAGTGTATATGAGAGTGGGATTTCTATACAAGTGTGAGAGCTTGTTACGAAAAATT
GTGTTAGAATTTTCCAAGTGCAAAAGTTAGCAATAACTTATTAATTTTAAAAATAGCCTG
GAAGTCACATTTTGCCATTGAAAAAGAGAGCTTCGCGCGCGAGACGATTACATGAACAGT
AGAGCGAGAGAGAGAGAACGTTGCCCGATCATCAGCTTGTCCTCTCTCTTTCGCTTTGGC
AAAAAAGAATATCAGTTCTTTGAATTTTAATGCATGCTTCCCAGCTCCACTAAGCCTGCC
ACGTGGTGGCTAAACGAGTTCTACACTCTCGGCGATGCATGCTCCATCAATTTTTGTTGC
AAAAGAAGATTTCACCTTTACAGGAGTTGCCTTATGTAACATTCTGTGTGGAGAGGAAAT
TGCTATGCTGTCCTAGTTTTCACTCATCTCTCTTTCTCTCATTCTCTCGGCTGCCTTTGG
CCCCCTTCCAATTGCACTTTCTATAGGGGGAAAAGTGGTTTTTCACACTCACGCAGTGCT
AAATGAAAAGTTCTCTCTTCAAGGCCACCACCAAACCAGACGTTGACATTGCTGTTGCCT
TTCATGTAATTTATCTCCTCCACTCCGTGTGCTTGCGTGCGTTTGTGTAGGTGACTTACT
CATTAATGAACCCAAAGTGTATGAATACAGGGTGCAAAATTTTCAGACTGCGTTCTACGG
ATTTCCAGAGCGGTCGATCTGTAAGGGAACGAAAGCTTAACTCACCAAAGCTAGTCTCCC
CCTCTGGCTTCAGTTTTCGAGTCACCCAAATAGAGAAATAGCGCGAGTACCTCACCCTAT
ATGAAAGCGCTTTGCCTCTCTGCAACGGCACTTTGTACTCATGCTCTCCCTCTTTGGGGG
CGAATTGTTGTGTCGCTCTCAAGTTCAAATAGTTGCATGCACCGCAATTAGCTGCATTGG
GAATTTGACCATAACATAGACCCTGCTGATGCATCGCTTTTTTGTGCGATGGTTATATAA
ACAATTAAAGTTTTCCATTGGACGATGCTTCCTACTGAAGTTAGCCTGTTGCTGAGCAAA
AAAATTATTCTGACGCAATGAGTAATTCTCACACCGTCAAAAGTCAGACGAGGGCGAACT
TCGAAAGCGTGTGTGAGAGAGGGCAACAACATGTGACCAGAGTAGAATCGTCTGTCTGAA
GTCTGTCTGAAGCTTTTTCGAGATGTCTGTGGGTGTGTATATCTGTGTGTGAGTGCTGAT
GACGTTGAATGGAGCACGCGTGGACTTTTGAGATGCGGAATGGTGCGTAGATAAGCTAAA
ATACCAGTTAGATAATGGCATTGTATTCCAATTAGTATTTACCTTATCACAGAGCTTATA
CACCCGCGTAATGCATTTTGAACAGGTTCTAGTTTCCGCTCATTGCTTATCACCTGTTTA
CATAACGGGGCAATGGGACAAAAACTTTTTTCATGGCACCCACTAATCATTCATTTTCTT
TTTCTTCAACCTTTTAGTCGAGTCCGTGTTAACACATAAAACACACACACATAATCCATA
ATGGGCGTTCCAGCTGGTGATGTTGAGAAGGGCAAGAAGCTGTTCGTGCAGCGTTGCGCA
CAGTGCCACACCGTGGAGGCTGGTGGCAAGCACAAGGTCGGTCCCAATCTGCATGGTCTG
ATCGGTCGCAAGACTGGCCAGGCTGCCGGTTTCGCATACACGGACGCCAACAAGGCCAAG
GGAATCACCTGGAATGAGGATACCCTCTTCGAGTACCTGGAGAACCCCAAGAAGTACATC
CCCGGCACCAAGATGATCTTCGCCGGTCTGAAGAAGCCCAATGAGCGCGGTGATCTGATT
GCCTACCTGAAGTCTGCCACCAAGTAAGGCGCCTCCTGATAAGGAGCCTCTACTTTCAAT
CACCTCACCACCCCAACAACAGGATGTATTATTGTGTTCAGTCACAATCCAACAGCAACA
CCAACAATATGAACAGCAGCAGAAGCAACAATTACATACAGACCTAAAAACTACAATTAT
GTTAATTATAAAGTTTAAATAGGAAAATTTATTATTTAATTTAAATAAAAAGTGGAATAC
TTAATTTAAAGCTGAGGAAACTTGTGACAACCACGTAAAACAACAAAAAGTTAAATAATA
ACAAAAAACAAAAACAAAAATAAAACTGTCGGCATTTTTGTTCTATTGGAAGGAAGGAAA
AGCATTTGCTTTCGTTGATCGATCTATAGGTCCCAGTAACTTGCACGTAACAAAGAGTAC
CGGGAAAGAGGTCTATAAGTTTTAAGGGAACTCCCAACTCTTAATCGGACACATTGGTTT
CTTAAACGATAAAGAGAAATTTTAGATTGCAAACAAAAACTAGACTGATAGAATTTGCAC
TTAAAAATGCCAATTCAAAGCTTCCATAGTCAAAACTTGTAGATTATAAATCAATATTTC
TCTGATAGGGTTTTATTCAACTTAGCAATTCCGAACAGCTAATCATACAAATAGGGTTCA
AAATTCAAGAAAGAGAATTTGTGCAAGAAATATTTCTCTGATAACATTTCATTCAAGCTT
AATTAATAAAGAGAAACCCCTCCCACATCACGTGCTAAAGACCTATGCTAGTAGTAGTTA
CTTCTACCATACAATAAAGAGAGGCCCGTAAGGCACTTAGTTCCAATATCTCGTGCCTTA
GATAACACCTGATATTGAACTATGGAACCACTTCTCAAAGAGAAACCAAAACACACATTG
AATCACGATTCTATGAAGTAGATAACAAAAGAGAGCACAAAAATTGGTATACAAACTGAA
ATCCTCTCTTAATTCTCTCTTAATTAGCTCATATCATACATACTATTTCAGAATGGAATA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004