login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG9698
Organism Anopheles gambiae str. PEST
Gene Name agEG9698
Product NADH-ubiquinone oxidoreductase 23 kDa subunit (NUIM) (By similarity)
GENE MAP
Chromosome 2R
Celera Gene agCG50843
Citogenetic Map 8D-9A
Gene Map
Comment This record is derived from the following: gb|AAAB01008987.1 gb|BM590400 5', mRNA sequence gb|BM647216 5', mRNA sequence gb|BX048350 5', mRNA sequence   The following contributed to reference sequence development: bases 1..2968 - AAAB01008987.1 7365348..7362381
PRODUCT
Function May donate electrons to ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000009698
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008987.1
Sequence Location 7365348..7362381
Sequence Lenght 2968bp
Relative Gene location 1007 .. 1980
CDS
CDS Location 1125 .. 1876
Sequence Lenght 218aa
Translation MSAVKIFSLAKQGNRLIRPASFSTAAARCYSSQAKPAAIKPEEYYYVNNKEQSMDMNDIT
DRAAQTIFWTELFRGAAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCI
ACKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFE
FSTETHEELLYNKEKLLSNGDKWESEIATNINADYLYR
mRNA
mRNA Location 1007 .. 1980
5'UTR Location 1007..1124
3'UTR Location 1877..1980
Exon 1007..1165,1261..1980
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CTTCACACGGTGCTGTCAAAATTCTCTCGAAAGCAGAAACGAGCCGAAAAAAGTTTTGCA
ATCGTTTGCAAATAGTGCAACTCCCGGACAAGAATCGCGGAATACGACGGAAGCAACC
AT
GTCGGCCGTAAAAATCTTCTCGCTGGCCAAACAGGGTAA
CCGACTGATCCGTCCGGCTTC
GTTTTCCACCGCCGCCGCACGGTGCTACAGCTCGCAGGCCAAGCCCGCTGCAATTAAACC
GGAAGAGTACTACTACGTGAACAACAAGGAGCAAAGCATGGACATGAACGACATTACCGA
CCGTGCGGCCCAAACGATCTTCTGGACGGAGCTGTTCCGCGGTGCCGCCGTCACCCTGGC
GCACATCTTCAAGGAGCCGGCCACCATCAATTACCCGTTCGAGAAGGGACCGCTCAGCCC
ACGGTTCCGTGGCGAGCATGCGCTGCGCCGCTACCCGAGCGGCGAGGAGCGCTGCATTGC
GTGCAAGCTGTGCGAGGCCATCTGTCCGGCGCAGGCCATCACGATCGAGGCGGAGGAGCG
TGCGGACGGTAGCCGGCGCACGACGCGCTACGACATCGATATGACCAAGTGCATATACTG
TGGCTTCTGCCAGGAGGCTTGCCCGGTCGATGCCATCGTCGAGGGGCCGAACTTTGAGTT
CTCGACCGAAACCCACGAGGAGCTGCTGTACAACAAGGAGAAGCTGCTGAGCAACGGCGA
CAAGTGGGAGTCGGAAATCGCGACCAACATCAACGCCGACTACCTGTACCGTTAA
GAGCG
AAGCAGTGGCGTGATGTTAGGGCAGCCCAGCACGTCCCGTGTGGATAGCAACTATGTATA
ATAACAGATAATTAACACTGAAGAATAAAGCCTCCCAGC
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
CTGAAGTCCATGAACTTGCTCATTGTCACACCGCCATCTTCGAGCAGTTTCGTTATCTGA
AAAGAAGGATAGCAGCATTAACCTCAGGAGGGAAGTCATACGCATTCACGCATCGTAATA
CTCACCTTCGGGTCAAGTGTTCCTGTGATATAGCACTTTACACTTTTAAACAGATCATCC
TTAATCTGGAGGCTCTCCAAATTGACCCCGGCAGTCGCTGGGTCGGAATTCATTTTTTCC
ACACAAAACGGTTGTCGACCTTTTGCTATCCACAAAGCTGCACTGGGACTAAAGCATCTA
GCAGGAGAATGCTGCGGTCAGTAGTTTTCATGCAAGACGCGCAAACACCAACCGATTTTG
GCGAATTTTCATTCCGATTTTCCTCCGACCACGACACGCTACACCGCCAAGTTTTGTTTG
TGTATGTTGTGTGGCAGCTACAGTGTTGGTAAAGAGGGAGGCAAATACATCCCACCTACC
CCCTCAATCCTTCCACATCCGAACCATCACACAGGGCAAGCAAAACAACACGGCAAAACA
CACCCGCGAACGGCAAATGCAGCCTAATTTCTATCCATCGTTGTGCAGGGACGATGGTTT
GTGGTTTCTATTGTGATCGGGTTGGGAGCAGGGGAACTTTTCCGGTACAGATTTACAATG
GAGCAAACACCGAAACTCATCACTCTGCGACGCGCTTGTTCTTTTTCTTTTTGGCTTTGA
AAATTTTGTGACATTTGACAGCGCAGATTTTGACATTCCGCACTAAATGGACAAGAGAAA
GATAGTGAAGCTGTGATATGAGCGAAAAATAATTATTTTTTATTCAATTTCACTGGCTAT
TGGTACTAATTATCAATTTTGACACGGTCTCAAATATTCAAAGCGAGATCAATTGCCTTT
ATCAAAGTTGAAAATGAAACAGTAATAAATTTCGTAATATTATTGTATACACCTTGTGCA
CGATTGTAAACAAACGTGATGGAAATCCATTTGTAAATTTACGTAACTTCACACGGTGCT
GTCAAAATTCTCTCGAAAGCAGAAACGAGCCGAAAAAAGTTTTGCAATCGTTTGCAAATA
GTGCAACTCCCGGACAAGAATCGCGGAATACGACGGAAGCAACC
ATGTCGGCCGTAAAAA
TCTTCTCGCTGGCCAAACAGGGTAA
GTGCGGGCGGGTGACCTGCCATAACCGAGCTCGGA
TAATATTGTTTGCCTTGGCTTCGTGCCTTGACTTCATCCTGTGGTTGTGCTTTTAGGCAG
CCGACTGATCCGTCCGGCTTCGTTTTCCACCGCCGCCGCACGGTGCTACAGCTCGCAGGC
CAAGCCCGCTGCAATTAAACCGGAAGAGTACTACTACGTGAACAACAAGGAGCAAAGCAT
GGACATGAACGACATTACCGACCGTGCGGCCCAAACGATCTTCTGGACGGAGCTGTTCCG
CGGTGCCGCCGTCACCCTGGCGCACATCTTCAAGGAGCCGGCCACCATCAATTACCCGTT
CGAGAAGGGACCGCTCAGCCCACGGTTCCGTGGCGAGCATGCGCTGCGCCGCTACCCGAG
CGGCGAGGAGCGCTGCATTGCGTGCAAGCTGTGCGAGGCCATCTGTCCGGCGCAGGCCAT
CACGATCGAGGCGGAGGAGCGTGCGGACGGTAGCCGGCGCACGACGCGCTACGACATCGA
TATGACCAAGTGCATATACTGTGGCTTCTGCCAGGAGGCTTGCCCGGTCGATGCCATCGT
CGAGGGGCCGAACTTTGAGTTCTCGACCGAAACCCACGAGGAGCTGCTGTACAACAAGGA
GAAGCTGCTGAGCAACGGCGACAAGTGGGAGTCGGAAATCGCGACCAACATCAACGCCGA
CTACCTGTACCGTTAA
GAGCGAAGCAGTGGCGTGATGTTAGGGCAGCCCAGCACGTCCCG
TGTGGATAGCAACTATGTATAATAACAGATAATTAACACTGAAGAATAAAGCCTCCCAGC
CCGTAATAAGCGTAGTGCGCAGAAAGCCTCATTCGGAAGACGCGTGCGTGTAGAGAACTT
ACGCGAAATTTATTCTATGTAAAAACGGAAAAGCAGTTGGGACACGAATGCATAAACATA
ATTAAAAGGGACCTCTCCTCGGGCTCACTGGCCCGGTCCCGAGAGCGACTTGTCCATGAA
CTTCTTCTTGGCGAAGCAGAGCCACCATTTGTTCGGCTTTCCGTCCTCGCCGGAAAAGAC
GCGCTCGCACACGCGAATGCCAACCTCCTGGCGCAGCTGCTGCAAATACTGTCGCATCAG
TTCAGCCTCGGCCGGTGAGTTTGGCCGGGCGTACACGGCGTTCAGCGGAAAGCCCGCCTC
GCCCGGAATGTCGAAGCGCGAAATGGCCAGCGTGTACATTTCCTGCAGGCCCTGGTTTTT
GTTCGCGCAGCGCTGCAGCTTCTTCAGACACTCCGTCACGTAAAGCGTGATGTAGATCAG
CACCCGGTCCACCTCCGACTTGATCTCGTACGTGCGGAAGAACACGTTCGCCTTGAAGTA
GTACAGCGTTTCGTCGATGATGTCCTGCTCGAGGCTGGCATTTACCGGAGCGGGCCCGCG
GGCCTGCGTCCGGATCGGCAGAATGGCCATATTGCCCACGGACTGCGAGTAATCCTTTAT
CTGTGAATGGTAGGCCTGCAAACGGGGGGGGGGAGGGTCAAATCATGAATCTCTTCGCCC
AACACTACTGTTATCTTCAGGAAGTTTTGCCCTATCAACGACACACCCCGACTAGGGTTT
GGGGCGATTGTGATGACTAATGCCCTCGGGACAAAAGTGCTAACAGGTCCAGGATAACCA
TGTCCGGAGTTTAATACTGCTCAAAAGGTTCTCCAACTTACCGGCATTGTAGTAGTAGAG
TTTATTGACCGTAGGATAGCTTTACTTAATTATTATTGACTAAAAACTACGCACAGTGCA
GCTCTTTTGGGAAGTTGGTTTCGTTTTT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004