login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG17602
Organism Anopheles gambiae str. PEST
Gene Name agEG17602
Product Cytochrome c (CYC) (By similarity)
GENE MAP
Chromosome 3R
Celera Gene agCG49752
Citogenetic Map 34C
Gene Map
Comment This record is derived from the following: gb|AAAB01008839.1 gb|BM631752.1 5', mRNA sequence gb|BM577355.1 5', mRNA sequence gb|BM624474.1 5', mRNA sequence The following contributed to sequence development: bases 1..4006 = AAAB01008839.1 655255..651250
PRODUCT
Function Electron carrier protein. The oxidized form of the cytochrome c heme group can accept an electron from the heme group of the cytochrome c1 subunit of cytochrome reductase. Cytochrome c then transfers thiselectron to the cytochrome oxidase complex, th
Subcellular Location Mitochondrial matrix
EC Number  --
Functional class Oxidative phosphorilation; Others
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0006917
Biological process: induction of apoptosis.
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000017602
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008839.1
Sequence Location 655255..651250
Sequence Lenght 4006bp
Relative Gene location 1004 .. 2698
CDS
CDS Location 2019 .. 2345
Sequence Lenght 108aa
Translation MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGFSYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMVFAGLKKPQERGDLIAYLKSATK
mRNA
Alt Form mRNA 1
mRNA Location 1004 .. 2698
5'UTR Location 1004..1074,1998..2018
3'UTR Location 2346..2698
Exon 1004..1074,1998..2698
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CCCGTGGCGATTACACGCGTTTGCACCCGCTCCCGCTTGGGTTGAAAATTTTCCTTGCCT
AACCGCGCTCT
TCAAATCTTTAACCAACAACAATGGGTGTCCCAGCTGGTGATGTTGAGA
AGGGCAAGAAGCTGTTCGTGCAGCGGTGCGCCCAGTGCCACACCGTCGAGGCCGGTGGCA
AGCACAAGGTCGGCCCGAACCTGCACGGACTGTTCGGCCGCAAGACGGGCCAGGCCGCCG
GCTTCAGCTACACCGACGCCAACAAGGCCAAGGGCATCACCTGGAACGAGGACACGCTGT
TCGAGTACCTGGAAAACCCGAAGAAGTACATCCCCGGCACGAAGATGGTGTTCGCCGGTC
TGAAGAAGCCGCAGGAGCGTGGCGATCTGATCGCCTACCTGAAGTCGGCCACCAAGTAA
G
GTGCATAAGGGGTCGAATTACCCGTGGGGGTGTGCGGTGGTGCGCGTGGTGTACTGTTAA
GAACGGGTATCGGTGTCCTAAATTCAGCCAAAACACTGCTACAGATAGAAGAGAGAAATA
AGAACACACACACACTCACTCAAGCTTCTTCTCCATTGAGATTCGGAACGTTTAAGATCA
GCAAAAGAACCGTAAGAAATAGGAAACAGACAGATAGAGAGATAGGCATGAGCGCACAGA
GAGAGAGAGGGAGAGCGAGCATCCTTTCGCCAGATGGGAAGGCTCCACACCCCACCCCAT
CCAAACGATTAGGACAATGTCTATGTAAATCTATTTAATTTAATTTATGCTA
mRNA
Alt Form mRNA 2
mRNA Location 1004 .. 2698
5'UTR Location 1004..1267,1998..2018
3'UTR Location 2346..2698
Exon 1004..1267,1998..2698
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CCCGTGGCGATTACACGCGTTTGCACCCGCTCCCGCTTGGGTTGAAAATTTTCCTTGCCT
AACCGCGCTCTGTAAGTATATCTGTATTTTTAGATTTTCGTGAAACCACCGCCAAAGAAA
GCAAGAAAGGCTCATTGTTTTGATGCGGTCTAGTGGATTTCTTTTATTGGGTCGAAACAC
CCCCCAAGTGTAGAGCTGTGAATCTCGCGGGCCAATCATTAGTGCTCGAGCCAAGCGGTG
GTGTGGTTTAGCGTTTTCAAGCAG
TCAAATCTTTAACCAACAACAATGGGTGTCCCAGCT
GGTGATGTTGAGAAGGGCAAGAAGCTGTTCGTGCAGCGGTGCGCCCAGTGCCACACCGTC
GAGGCCGGTGGCAAGCACAAGGTCGGCCCGAACCTGCACGGACTGTTCGGCCGCAAGACG
GGCCAGGCCGCCGGCTTCAGCTACACCGACGCCAACAAGGCCAAGGGCATCACCTGGAAC
GAGGACACGCTGTTCGAGTACCTGGAAAACCCGAAGAAGTACATCCCCGGCACGAAGATG
GTGTTCGCCGGTCTGAAGAAGCCGCAGGAGCGTGGCGATCTGATCGCCTACCTGAAGTCG
GCCACCAAGTAA
GGTGCATAAGGGGTCGAATTACCCGTGGGGGTGTGCGGTGGTGCGCGT
GGTGTACTGTTAAGAACGGGTATCGGTGTCCTAAATTCAGCCAAAACACTGCTACAGATA
GAAGAGAGAAATAAGAACACACACACACTCACTCAAGCTTCTTCTCCATTGAGATTCGGA
ACGTTTAAGATCAGCAAAAGAACCGTAAGAAATAGGAAACAGACAGATAGAGAGATAGGC
ATGAGCGCACAGAGAGAGAGAGGGAGAGCGAGCATCCTTTCGCCAGATGGGAAGGCTCCA
CACCCCACCCCATCCAAACGATTAGGACAATGTCTATGTAAATCTATTTAATTTAATTTA
TGCTA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GCGCCAGATAGTACAGCGTGAGCGTGTGGTTCGATTCGAGCAGCTTCAGCCCCTTGCCCT
TCTCCACCTCTTCCTTTGTGCCGAACAGATCGGCCATCGTGAGCGGTTGCCGGTCCAGCT
CCTTCGTTTCGCAGTAGATGTCCTTCGCCTGGTCGAGATACTGTTTCGATTCGGCAAAGT
TGGACAGATTGCAGGCCATGATGCCGAGCTGGTTGAGTATTTCAATGTGCACGTTGATGG
TCGGTTCCTTGCCGCTGTCCTTCTCGATCAGCTCGAGCGCCTCCTTCAGTAGTACTTCAC
CCCGTGGTTCCTCCACGAAGATCGTTATCTTGCCAATGTCTTTCAGAATGTTGGCGTGTA
TGCAGCGTACGGTTGTGGCCACTTCACTGTCCTGGTCCAGTGCTTCCGAGAGCGTTTTCA
CCTTTCGCAACGCACTGTTCAGCAGGTCGCGGGCGGTGTAGTGCGAACGGAACGGTTCCG
TCGGTGGGTCATTCTTGCTTTCCTCGTCGATGTAGCGGTGTGCTTTTTCGTAATCTTCCC
GAATGTCGGAAAGATTTTCCTTCGTCACTTTCATCCTGCACTGCTGGTTTTGCTCGATAA
TGGGTGGAAAACGGAGTGCGTTTTGCTGCGAGCGGAGAAAACAACAAACATTGATTTTGT
TGTTGTGCGTTTGACAGCTCTTTCGCATGGTGGGAGTGTCAAGGGATTTTACCTTTTATT
AATTTGGATTCAGAGAGGTGAAATGGAAGGAAATGAATTAAAAATATTGAACCATGTTTA
AAATACATTCCAAAGCAGATATTTACATTTTCTGACAATTTTAAATATATATTTTCCACA
GCCCGCGGATTGCACCAACGTGTACACGCTGCTTCATCACGGCCGATTTGCAGCTGTCAC
TTTCGCACGACCAGCAGCCGCCGCAACGGTGAACACATTTTTGCGCTGTCAAAATCTTTC
CTCGTGTGATTTCGCTCGCCCCCGTCTTGTTCTTTTTCGACATCCCGTGGCGATTACACG
CGTTTGCACCCGCTCCCGCTTGGGTTGAAAATTTTCCTTGCCTAACCGCGCTCTGTAAGT
ATATCTGTATTTTTAGATTTTCGTGAAACCACCGCCAAAGAAAGCAAGAAAGGCTCATTG
TTTTGATGCGGTCTAGTGGATTTCTTTTATTGGGTCGAAACACCCCCCAAGTGTAGAGCT
GTGAATCTCGCGGGCCAATCATTAGTGCTCGAGCCAAGCGGTGGTGTGGTTTAGCGTTTT
CAAGCAGGTACAGCAGACAAGCGCTCTCTTGATAGAGTGGGGGGTGATGGGAATCTTTTT
CCCGCCCTGACCAAATTTCCGATCGTTGTGAAGTGAATCTCGAGCATAGGCTGACTGCTT
CGATTTTGCACCGTGTGGCGTTGACCCAGTTTCGGTGCCTAGATACTGCAAGGGAGCATT
TTCGCCAACTTACGTAATGTGCTCGCGAAACAAAAAGGGAAGAAATCCCTGTGTCAACGT
AATGTGAGCTTGGCCTCCGCCACGAGGACAGAGCAGCAGCCACCGAGATAAGGTGCCTTC
GTGTGCAGGCCTTGAAATAGTTCGTCGCCATGACGACAGTGGGATGGATCGAAGCAGAAA
ATCCCTACTTGGATGGAAAAGAATAATGTAGAACAATAATTACATCACACGTGAAAGGTC
ATTACGTCACACGCTGTGGCTTAAAAAGGGTCGAACTCCGCACGGGCGGCGAAGGGCGCG
TGACCTTGGTGTGATAAGGTCTTGGTGCATGGAGGGGGAGGATTTAACACCTCGAGAAGT
CGCGGAAGTGGTGCGATTACGAGCGTTACATGGAAATCCTTTCACGCCACTGATCACCTG
ATTATCGGCGGAGGGTGGTGGGGTGGTGAAATGTACCCTTCCCACAGTTGCATAATGTGT
TGCAATGTTGCACGTGATTGTAATTGATTGCATTTATTGATTTTTTTTCGTCTTCTTCTT
TCAACTCCTCTCCACAGTCAAATCTTTAACCAACAACAATGGGTGTCCCAGCTGGTGATG
TTGAGAAGGGCAAGAAGCTGTTCGTGCAGCGGTGCGCCCAGTGCCACACCGTCGAGGCCG
GTGGCAAGCACAAGGTCGGCCCGAACCTGCACGGACTGTTCGGCCGCAAGACGGGCCAGG
CCGCCGGCTTCAGCTACACCGACGCCAACAAGGCCAAGGGCATCACCTGGAACGAGGACA
CGCTGTTCGAGTACCTGGAAAACCCGAAGAAGTACATCCCCGGCACGAAGATGGTGTTCG
CCGGTCTGAAGAAGCCGCAGGAGCGTGGCGATCTGATCGCCTACCTGAAGTCGGCCACCA
AGTAAGGTGCATAAGGGGTCGAATTACCCGTGGGGGTGTGCGGTGGTGCGCGTGGTGTAC
TGTTAAGAACGGGTATCGGTGTCCTAAATTCAGCCAAAACACTGCTACAGATAGAAGAGA
GAAATAAGAACACACACACACTCACTCAAGCTTCTTCTCCATTGAGATTCGGAACGTTTA
AGATCAGCAAAAGAACCGTAAGAAATAGGAAACAGACAGATAGAGAGATAGGCATGAGCG
CACAGAGAGAGAGAGGGAGAGCGAGCATCCTTTCGCCAGATGGGAAGGCTCCACACCCCA
CCCCATCCAAACGATTAGGACAATGTCTATGTAAATCTATTTAATTTAATTTATGCTAGA
ATTAAAATAGTTTGACAGAAATCGGTTTTTGATCGATCGCCGGGAAACTGGAGGGAGGAG
AAGCGGGGGCAGTCGCGCGTGTGTTTCGACGCACGGATCTTGTGTGGTGCCACGGTGGTG
GCACGGTTCTCTAGCAGACGATCCTTTCCAGCGATTGTTTTTGCGTGACTTGGGAGGATC
GTTCTGTAGGATGATGGTGCGCGTGGCATCGGCGGTTCGGACACAATCGGATCCGGTTTA
GTTCAATTTTCAGCAAATCGAACGTTGTAGTATTATCACTATCAAAGAGAATTGTTTTCA
ACCCAAAAAACGGAATGAGGTGTGACGCTGAATAAAAAACACGGAAACCAAAACAGTAAA
AACAGTTGTTTCGTAAAATTGAGCCAAATGGAACTGGGGAGCGTATGGGGGGATATGCAT
ACAATTTCGTGGAAAAAATCTTAATCATTTGAAGATGATGCCACCGAAACATCGCGAAGG
AATTGGTGGGGGGTTGAAAAACAGACCCCCGGATAATCGAGAGCGAGTAGGTACTGACCG
ACTTTCTTTTGCAGTGTCACCCTGTGTTGAGTTTGTGGAATGAAATTATTTATTTTTTTA
GAATTTTGATGAATTAAGGCAACATTTTGCATTCATTATTAATCAAGACAATTTTTTAAC
GAATTCGTAGTTCAATTTCGAAGAAGAATTAAAATAAATTGATCAAAGTGGTGATATACA
TAGAGATGAAAAAGATGACATGGCACAGTGGGAGGTTTCCATGAGAATCCTTCCTTTTTT
ATTTCGATAATTTTACGAAAAATATGCTCAAAATGGTCTAATTTATTTTTTTAAGGCACA
TTTACGCAATTTGCAATTTTATTCAATTCATTCAACGCTTTAAAAAATCCCAAAATAAAT
TGTTTTGATTTCTCCACAGCGTTTCCATTTGTCATCAAAGCTGTCAAGCGGCCCCGTCCG
TGCACGAGCTCCCGCTGTGCGCCAGTGAGAGTGCAGAAGCAGCGGAAAATCGATTTTTAT
CCTTAATCTAAACGCAAAGCGAAGGCTCCCCGATTTGCGTAAGAAAAGGAGCAGGCAGCA
GATTGCCAGCACACAACATACAAACACCGAACGGAACATCCTGCCCGCAAGTGAGATCCC
GGTTTCGAAGGGTTGTTGTTCGACGGGGTGCTTAAGTGCTGCACGATTGCAGGCCGTGGT
GCATCGGTATTTTTTCCGAACAGCGAAGAGAAGACACAGTAAGGGTGGGTAAGCATCGCT
CGTCATCATCATCATCCGAATCTGTGAATCGCACGAAAAGCGTCAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004