login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG3944
Organism Drosophila pseudoobscura
Gene Name Dpse\CG3944
Product NADH-ubiquinone oxidoreductase 23 kDa subunit (NUIM) (By similarity)
GENE MAP
Chromosome pseudo2-mel3R
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig4374_Contig4847 The following contributed to reference sequence development: bases 1..3000 - Contig4374_Contig4847 1294022..1291023
PRODUCT
Function MAY DONATE ELECTRONS TO UBIQUINONE.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
SwissProt AC  --
HGSC (Dpseudoobscura) Contig4374_Contig4847
View Sequence REFERENCE SEQUENCE
Contig Contig4374_Contig4847
Sequence Location 1294022..1291023
Sequence Lenght 3000bp
Relative Gene location 1035 .. 1944
CDS
CDS Location 1035 .. 1944
Sequence Lenght 217aa
Translation MSLTMRIFTASRNGQRMFRTNGACLLAAKRTEPKDIVEVPKGYVYVNNKELSMEMEDITD
RAATSMFFGELFRGFGVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIA
CKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEF
STETHEELLYNKEKLLCNGDKWESEIASNLQADHLYR
mRNA
mRNA Location 1035 .. 1944
5'UTR Location  --
3'UTR Location  --
Exon 1035..1074,1267..1718,1783..1944
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGTCGCTTACTATGCGAATTTTCACAGCATCCCGCAATGGTCAGCGCATGTTTCGCACC
AATGGCGCCTGCTTGCTGGCCGCCAAGCGGACCGAACCCAAAGACATTGTTGAGGTCCCC
AAGGGCTATGTGTATGTGAATAACAAGGAACTGAGCATGGAGATGGAGGACATCACCGAC
CGGGCGGCGACATCAATGTTCTTTGGCGAGCTCTTCCGCGGCTTTGGCGTCACACTGGCC
CACATCTTCAAGGAGCCGGCCACCATCAACTATCCATTTGAGAAGGGACCTTTGAGTCCC
CGCTTCCGGGGCGAGCACGCCCTGCGTCGCTATCCCAGCGGCGAGGAGCGTTGCATCGCC
TGCAAGCTTTGCGAGGCCATCTGCCCCGCCCAGGCCATCACCATTGAGGCGGAGGAGCGT
GCCGATGGCAGCAGACGTACGACGCGCTACGATATCGACATGACCAAGTGCATCTACTGT
GGCTTCTGTCAG
GAGGCCTGCCCTGTGGATGCCATTGTCGAGGGACCCAATTTCGAATTC
TCCACAGAGACGCACGAGGAGTTGCTGTACAACAAGGAAAAGCTGCTCTGCAACGGCGAC
AAATGGGAGTCTGAGATTGCGTCCAATCTGCAAGCGGATCATCTCTATCGTTAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TAAACAACGCAAGCAAAAAGTTTATAAAAGTGCAATTGTAGCACTTTTTAGGTGCTGGCC
TTCTCTTACCCCATTCATGCGCTCCTTCTCTTTTTCGACAAAGCTCTTCACATAGTCTTT
GCCCACAATTTCGCGTTTGATCGGCTTCTCTAATTCCTCAGATTCCGTCACAAAAGCGTG
CACATTGCTCGATACATGTCCGCGCGGTGCTTGTTTTCGTACGAATTCCTTCGAAAAGTC
GAAGAAATCCATTAGTTCTTGGTCCATTTTTAAAGCGGAAATTTTTTTTTCGGAATTTTT
CGGCGTTCTACGATTCAAACTGTAAATGTAAACCAGTGTGACCGCGGATTTAGCACGGTT
AAATACACAGTCTGACCCTCAGAAATATACGTAGAATATACTGACGAATTATCCAAGGTC
TATTTTAGTCCTTGCTTTTATTGTATTTTGACTAAAACAAGGTTTGAACAAAAAAGTTCA
ACAAAAAAACAGTCGCAATGTTATCACGTCAATGTTGCTTGTCAACCGGAGTATGGTATA
ATGGTATATTTAGGAAGAAGGGGTATAGAAACATCTTTTGAATTTCGCTCTCAAATCTTT
CTTACGTGTATCATTTATTCCAATAGATTGCATTTAAATCTTTTTCGCACATTCACTTTC
AAACAATTTCTATTTGGCGCGCACCACTTATATACAGTCGATAGTATCGATAATCGAACT
TGAATCGGGTAGGAAGGCTCTCTTCTTTTTTTCTAGTCAAAATACAATACATGCGAGTAA
TTAAAGGTACTTAATCTTATACAAAATTTATTCATCAATAGGATGATAGGATGGGTAAAG
CTGAGAGATCTAAACAGCTAGTAATATTCGACGAAATATAGAAAATGAATTCGTAAGTAT
ATTTACGGTATTTGAGACGGCATATTTCTGAGGGTCGGACGGTATATTTTAACGATAAAT
CCGCGGTCACACTGCTTATCGGAGAAATATCAAACAAAATCTAAAAATTTTACCTGAATT
TTGCCGCCGCAGACATGTCGCTTACTATGCGAATTTTCACAGCATCCCGCAATGGTTAGT
GGTTGGGCAGTAGCTTGCCTTGCACTCAAAGCGCGACATGCGAAATACCCGACTATTCCA
TGGGCATCGCATTGAGTGAGGTTATGTAAGCTTATGTCATAGCAAAACAAAGGACTAAAG
TGGCCAATTATTGTTCCGCGGCGGCTCACACAAGTGCACTGTATTGACGATATGTCTCCC
CCGCAGGTCAGCGCATGTTTCGCACCAATGGCGCCTGCTTGCTGGCCGCCAAGCGGACCG
AACCCAAAGACATTGTTGAGGTCCCCAAGGGCTATGTGTATGTGAATAACAAGGAACTGA
GCATGGAGATGGAGGACATCACCGACCGGGCGGCGACATCAATGTTCTTTGGCGAGCTCT
TCCGCGGCTTTGGCGTCACACTGGCCCACATCTTCAAGGAGCCGGCCACCATCAACTATC
CATTTGAGAAGGGACCTTTGAGTCCCCGCTTCCGGGGCGAGCACGCCCTGCGTCGCTATC
CCAGCGGCGAGGAGCGTTGCATCGCCTGCAAGCTTTGCGAGGCCATCTGCCCCGCCCAGG
CCATCACCATTGAGGCGGAGGAGCGTGCCGATGGCAGCAGACGTACGACGCGCTACGATA
TCGACATGACCAAGTGCATCTACTGTGGCTTCTGTCAG
GTAAGGAATGGGAGTCGAAATT
TTTACATAATTTCAAGTCGATTCATTGACTTTTTGCTCGTAGGAGGCCTGCCCTGTGGAT
GCCATTGTCGAGGGACCCAATTTCGAATTCTCCACAGAGACGCACGAGGAGTTGCTGTAC
AACAAGGAAAAGCTGCTCTGCAACGGCGACAAATGGGAGTCTGAGATTGCGTCCAATCTG
CAAGCGGATCATCTCTATCGTTAA
TGTCGGTTGTACATATACTAGAATCCTTTGTTTAGA
ACGATTTTCCAATTAAATATCGTTGCCGTGGCTGCGTCTCAATAGACGACCTTTTGTTAT
TGTACAGTTAATACTGCATAAAGGAGCGGGCGGAACGATATTAAATAATTTATGTATTAA
ATTTCTTTATAGAACGAAATACTACCAGTGTTTCAATGCAATTCGATATTGGAATGGAAC
GGGAACGGCTCTACTGTCCCGGGCCAGCCAGGCTCTTCTCCATGAACTTCTTCTTCGCAA
AGCACGTCCACCACTTGTTTGGCTTGCCATCCTCGGTGTTAAAGACTCTCTCCACCACAC
GATTGCCGGTCTCGTGGCGCAGCTGCAACAGATACTGACGCATCAGGTCTGAATCCTGGG
CCGTTTGGGGCTTCGCATAGACGGCGTTCAAGGGGAAGCCAGCGTCGCCGGGTATGTCGA
ACTTGGAAATGGCCAGGCTGTACATCTCCTGCTGTCCCTGACCCTTGCTGGTGCATCGAT
TAAGCCGCTTCAGGCATTCCGTTATGTACAGTGTCACGTAGATGAGAACGCGGTCCACCT
CCGACTGGAATTGCGAGAGTATAGTCACATATGTATGTATGTACTGTAGATATTGGATTC
TTACTTTGATTTCGTATGTGCGAAAGAATACATTGGCTTTGAAAAAGTATAGTGACTCAT
CAATGATGTCGTTCTCCACATTGGCACTGGGCGCTGGTCCGCGCACCTGGGTACGGAGGG
GCAGGATGGCCATGTTGCCCACTTGTTGGGGGAACTCCTTGATCTGGGAGTGGTAGGCCT
AACAAACAAAAACTCATTAAATGTATGACAATAATATTTTCGTACACCCTTGCTTTGCAG
GGGGTCTTTAGCAAATCGAATCAAAGAAAAACACACATGTCCTCCAACAGGAACCCACTC
ACCGGCATGGTATTTATGTGAAAACAAAATAGCAGGCTATATATATAAATTAATAACAAT
TATATTGTTCTTTTTGGCAAAAACAACAATTTCTCGGACTGCTTTGCACTGTTTTTTCCC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004