login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG3944
Organism Drosophila melanogaster
Gene Name ND23 (CG3944)
Product NADH-UBIQUINONE OXIDOREDUCTASE 23 KDA SUBUNIT (NUIM) (By similarity)
GENE MAP
Chromosome 3R
Citogenetic Map 89A5
Gene Map
Comment This record is derived from the following: AE003710 gb|AY070919|AY070919  RE02647 full length cDNA Reference sequence based on BDGP genomic sequence.
PRODUCT
Function May donate electrons to ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0008042
Molecular function: iron-sulfur electron transfer carrier.
SwissProt AC  --
FLYBASE FBgn0038370
View Sequence REFERENCE SEQUENCE
Scaffold AE003710
Sequence Location  --
Sequence Lenght 3060bp
Relative Gene location 1037 .. 2087
P-insertion P{PZ}spn-E-hls-03987
CDS
CDS Location 1105 .. 2009
Sequence Lenght 217aa
Translation MSLTMRIFTASRNGQRLFGSHGARLLAAQRAEPKDIVEVPKGYVYVNNKELSMEFADITD
RAASTMFFGELLRGFAVTLAHIFKEPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIA
CKLCEAICPAQAITIEAEERADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEF
STETHEELLYNKEKLLCNGDKWESEIASNLQADHLYR
mRNA
mRNA Location 1037 .. 2087
5'UTR Location 1037..1104
3'UTR Location 2010..2087
Exon 1037..1144,1328..1779,1848..2087
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
AATTTGTTCGGGCAAATTCAATAGCAAAACAACTTCTTTGGCAATTTTAGTTTAATTTGG
TCGCAAAA
ATGTCGCTAACTATGCGAATTTTCACCGCATCGCGCAACGGACAGCGCCTGT
TTGGCAGCCATGGAGCCCGGCTGCTGGCCGCCCAGCGAGCAGAACCCAAAGATATCGTCG
AGGTTCCCAAGGGCTATGTGTATGTAAACAACAAGGAACTGAGCATGGAGTTTGCCGACA
TCACGGACCGTGCTGCATCCACCATGTTCTTCGGTGAACTCTTACGTGGATTTGCCGTCA
CCCTGGCGCACATCTTCAAGGAACCGGCCACTATCAACTATCCCTTTGAAAAGGGACCAC
TGAGCCCGCGATTCCGCGGAGAACATGCCCTTCGTCGTTATCCCAGTGGAGAGGAGCGCT
GCATCGCTTGCAAGCTATGCGAGGCTATTTGCCCCGCACAGGCGATCACCATCGAAGCGG
AGGAGCGCGCGGATGGCAGCAGACGTACCACACGCTACGATATCGACATGACCAAGTGCA
TCTACTGCGGATTCTGTCAG
GAAGCCTGTCCCGTGGACGCCATCGTCGAGGGACCCAACT
TCGAGTTCTCCACGGAGACGCACGAGGAGCTGCTGTACAACAAGGAGAAGCTTCTCTGCA
ACGGCGACAAGTGGGAGTCCGAGATTGCCTCTAACTTGCAGGCCGACCATCTCTATCGTT
AA
AGTTGCTTGTACCCCTAGAATTCCTTGTTTAGAACGATTTTCCAATTAAAGATCGTTG
CTGTGGCTTCGTCTTAAGCG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
ATTATTTATTATATAATATTAAATACTCTCGACTAGTTTGGATTTGAATTTCAAAAGTCG
AGGATAAAAGGTTTAATTATAATTCGCTTGCGTTGGCTTTATTAAAATATAGACTTAATA
AAAAAGTTAGGATTTTATTTAAGTTTTGCTCACCTGCGTGGTCTTGCCACATCCTGTTTC
GCCCTTAATAATGACTACCGGATGAGCATTGATGGCCGCCAATATTTCCTCGCGCTTGGC
GTAGATGGACAAGTTCTTGTCGCGATTCAGATTGAATCTGAACTTCTTGTAGTACTCGTC
ATCCCGGCGAATTTCGGTCTCTTCCCCCTCATCGTCGGTGTCCAAATCGTCCAGCGTTCG
AATGCGTTTGCCTTGAGGCTGTTCGTTGAGCAGCGTCTGGATCGAATTACACATAAACAA
ACAGAAGTGCTGACGCAAGCTTCCAGTTCTCACCCCGTTCAGGAGACACTTTTCCTTGGC
GACGATTTTGCTGACATAGTCGGTGCCGATCAACTCGCGGTTGGGCACTTCGGATGATTT
GAACTTCGTGGCCATTAGCCTCGGATCGCTGCTGATGTAGCCTTGCGGGGCGGCGGCCAC
GCGCTTCAACTCCTTCGAGAAGTCAAAGAAATCCATAACCTCCTGATCCATTTTCCGACA
TAAACAATGAAAAATTTCACAATTCCGCGTAGCGGGAAAAGTTAAACTGTAAATTGTAGT
GGTGGGGATTTTCAAAGTCAATGTTGAAAAGTGTAAAAGTGCGAATTTATATCGATAGTG
CCATTATCGAAGCTTTAAGGTTTTTATTAGGGGTATTCGTATAAAAAAAATGTTTTCTTT
TTTTTCTCACAGTCTTTCTGGATTATTTGTTAATATTATTTATTATTTTTACACGAATAT
TTAATTCTTTGTTACATTATTTATATTTTATATCTCATATTTTATTTTTGGTTTATGTCA
TTAAGAAACTACGATATATTTGAATACGATATTTGAGCATTGAATTTATGTGGGTAATCG
AAAGAAACCCAGCTCTAATTTGTTCGGGCAAATTCAATAGCAAAACAACTTCTTTGGCAA
TTTTAGTTTAATTTGGTCGCAAAA
ATGTCGCTAACTATGCGAATTTTCACCGCATCGCGC
AACG
GTAGGTGGCGACCCATCCCCTCACATCCGTTGTTTTCCGGGAAATTTCCCATTTTC
GTGGAAATCGCGGCGAGTGAGGTTATGTAAGCTTATGTCATACCAAAACAAAAGTCTAAA
CTCGCTTAATTCAGTATAACTTTTCGACTTAAGCATGTTATTTAATGGTAAAATGTTCTC
CCCACAGGACAGCGCCTGTTTGGCAGCCATGGAGCCCGGCTGCTGGCCGCCCAGCGAGCA
GAACCCAAAGATATCGTCGAGGTTCCCAAGGGCTATGTGTATGTAAACAACAAGGAACTG
AGCATGGAGTTTGCCGACATCACGGACCGTGCTGCATCCACCATGTTCTTCGGTGAACTC
TTACGTGGATTTGCCGTCACCCTGGCGCACATCTTCAAGGAACCGGCCACTATCAACTAT
CCCTTTGAAAAGGGACCACTGAGCCCGCGATTCCGCGGAGAACATGCCCTTCGTCGTTAT
CCCAGTGGAGAGGAGCGCTGCATCGCTTGCAAGCTATGCGAGGCTATTTGCCCCGCACAG
GCGATCACCATCGAAGCGGAGGAGCGCGCGGATGGCAGCAGACGTACCACACGCTACGAT
ATCGACATGACCAAGTGCATCTACTGCGGATTCTGTCAG
GTGAGGAGGAGCAAAGTGGCG
CCACAATTTACTAGAAACTAATTGCATCTTTTTGTCCCCCCGCGTAGGAAGCCTGTCCCG
TGGACGCCATCGTCGAGGGACCCAACTTCGAGTTCTCCACGGAGACGCACGAGGAGCTGC
TGTACAACAAGGAGAAGCTTCTCTGCAACGGCGACAAGTGGGAGTCCGAGATTGCCTCTA
ACTTGCAGGCCGACCATCTCTATCGTTAA
AGTTGCTTGTACCCCTAGAATTCCTTGTTTA
GAACGATTTTCCAATTAAAGATCGTTGCTGTGGCTTCGTCTTAAGCG
AAAGTCAGTTGTA
TTTTTTTTAATTACTCAACTGGCCTAATAAATATAAATTATTTATATTCAAAGAGTTCCA
CGTTGTATTCGACAGATGACAAAGTTTATTTAATTAACAGGCCAATAGAAAGCATTTTTT
CCAATGACGGAGCGACTACAAATAAATGAAACTTAGTTAATACTTTACTATTCCGATTTT
GATTACACAAATTATAGGCAATAACTTCCATTTGCTGGTCAGTTATTAGAAACAGATATT
ATTTATGAAAGTTACTTGCAGTTTTATCCACGTTAATTTTGTAAAAAGAATTTACATAAA
TTAATTAAAACAGAAAGGCTTACAAATTCAAATAATTTATTTAGTGGTTAATGAATTTAA
TTAATTGTGACACGTTGGCAGTGATACTGCAAATTAGGACCACGCTGCGAGTAAAACTTA
ATTGAAGGGTATTTTTACCCGTCGTAGAAGCAAAACAAGATACCAGATATTGTGGATAGC
TGTTTATTGTCCAGGTCCAGCCAGACTCTTCTCCATGAACTTTTTCTTCGCGAAGCAGGT
CCACCATTTATTGGGCTTGCCATCCTCGGTGTTGAAGACCTTCTCCAGTACCCGGTTGCC
GGTTTCGTGGCGCAGCTGCAGCAGGTACTGGCGCATCAGATCCGCATCCTGGGCCGTTTG
CGGCTTGGCATAGACGGCGTTCAATGGGAAGCCAGCATCGCCGGGAATGTCGAACTTGGA
GATGGCCAGGCTGTACATGTCCTGCTGTCCCTGGGCCTTGCTCGTGGAGCGATTGAGCTT
CTTGAGGCACTCTGTTATGTAGAGCGTCACATAGATGAGCACGCGATCCACGTCGGACTG
AAAATGGTAAAACATAGTTTGTGAATTCAAGTAGCAAGTAGCATAAGGATTCAATATGAC
CATCACGTGACCAGGTAATGGTTCTGAATCCCGGATTACGGCCTCACCTTGATTTCGTAC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004