login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG12298
Organism Anopheles gambiae str. PEST
Gene Name agEG12298
Product NADH-ubiquinone oxidoreductase 20 kDa subunit (NUKM) (By similarity)
GENE MAP
Chromosome 2R
Celera Gene agCG55614
Citogenetic Map 14D
Gene Map
Comment This record is derived from the following: gb|AAAB01008879.1 gb|BX601726 5', mRNA sequence The following contributed to reference sequence development: bases 1..2597 - AAAB01008879.1 2516938..2514342
PRODUCT
Function Unknown
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0016655
Molecular function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000012298
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008879.1
Sequence Location 2516938..2514342
Sequence Lenght 2597bp
Relative Gene location 955 .. 1734
CDS
CDS Location 965 .. 1597
Sequence Lenght 210aa
Translation MLPIRAAFARANVFAAHRSPAGAAIVRLKATLPVVHGGQPPDPLPYSPFGAKQSNTAEWT
VARLDDLLNWGRKGSMWPTMFGLACCAMEMMQAAAPRYDIDRFGVLFRASPRQTDFIIVA
GTLTNKMAPALRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGC
PPTAEALIYGVLQLQKKVKRMKTVQMWYRK
mRNA
mRNA Location 955 .. 1734
5'UTR Location 955..964
3'UTR Location 1598..1734
Exon 955..1734
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
TTGCACGACCATGCTGCCCATCCGTGCTGCGTTCGCAAGAGCCAACGTGTTTGCGGCGCA
CCGTTCCCCGGCCGGTGCGGCCATCGTTCGTCTCAAAGCAACCCTTCCGGTTGTGCACGG
CGGCCAACCACCAGACCCGTTACCATATTCACCGTTCGGAGCGAAACAATCGAACACCGC
CGAATGGACCGTGGCCCGTTTGGATGATTTGCTAAACTGGGGCCGCAAAGGATCAATGTG
GCCGACAATGTTCGGCCTGGCGTGCTGTGCCATGGAGATGATGCAAGCGGCCGCTCCACG
TTACGATATCGATCGGTTTGGCGTACTGTTCCGTGCTTCCCCCCGGCAGACGGATTTCAT
CATTGTGGCCGGCACGCTGACGAACAAGATGGCACCGGCGCTACGCAAAATTTACGACCA
AATGCCCGAACCAAGGTGGGTTATTTCGATGGGCAGTTGCGCCAACGGTGGCGGCTACTA
TCACTACTCGTACTCGGTGGTGCGTGGCTGCGATCGGATCATACCGGTCGATATCTACGT
TCCAGGATGTCCACCGACGGCCGAGGCACTAATATACGGAGTGCTCCAATTGCAGAAGAA
AGTTAAACGCATGAAAACGGTACAAATGTGGTATCGCAAGTAG
GTATGCGATGTTTCTCG
TTAAGTAGAAGTGTTTTTTAAATGTAAGTGTTAGAGTTAACTGATATTAACATTTTGGTA
CTCGGGAAAGTGTGAGTTAGTAGGGAATCGCATATGGAAACTATCGCATCATGTTTGAAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GTTGATACGAGGCATACCGACACAACACACGCCCACAGCAACGCACCCAGCAACAGACGA
GGGTGTGTGTGTGAGTGTTGAGTGCGGACCGGGAGCGGAGCGGGTAGAGCAGGAACGAAC
AACCAGCCCCACCCTCCCAGCTAGACCGTTTGTGTACCGCCGATCCGGCTGGTGGCTAAT
CGCTTCAGCACGCACGGCGCCGGACACGTTGATCCTGGCGGACGGCTGGCAGACGGTACA
CGGTGCACTAATGCGTCTCGGCCAAGCTGCTGCAACCTTCTTGCGTACACCTTGAAAATC
GATAAAATTTTACCACTTTCGGACCACCATTGTCCAAATGTTTTCTTCTGCCATTGCCAA
GAGCGTTGACAGCAGCAACAACGTCATGACGGGATATAGCACAAAGAAGCTACTTTCACG
CACACGGATGCAGCATCGTCGCAGCGAAATGCACTACATTTGCGGAACAAAAATAATTAA
TTTCTCTAAATGCCTCATAAATAAGTGAAACATAAGCTCTTCGACTTTGTATGACTTTGA
CTGACTTTGTAAAAAAAACTCCAAAGAAATTTATTTCATGAACAAATAACATACAGTGGC
GTTACCTGTAGGATCAAATTTTGAGGCTTATTTCACGCAGCACAAGCGCGCAAGAAAATA
AATTTAAAATACAATTACGATCGTTTGGAGCTTAACACATGTTAACTCAACACAAAAAGC
TAATATTAGGCTTATAACACTTATTGTTCTGAAAAGTGTGAGAATACCAATTTGTTTGAC
TGTTCCAATTTATGACTTTCCCAATCTAATCGCGATTTATCGGAGTTACGGTGCGTTACA
TGCGAGATTATTAAATGACTCACTCACCATAATTACCCCTGCGAACGATATGTGTACACA
ACATCACCCTGGCCGCACCTATTATCATCAATAGTACAGCCAAGAAACTCCAAGTTGCAC
GACC
ATGCTGCCCATCCGTGCTGCGTTCGCAAGAGCCAACGTGTTTGCGGCGCACCGTTC
CCCGGCCGGTGCGGCCATCGTTCGTCTCAAAGCAACCCTTCCGGTTGTGCACGGCGGCCA
ACCACCAGACCCGTTACCATATTCACCGTTCGGAGCGAAACAATCGAACACCGCCGAATG
GACCGTGGCCCGTTTGGATGATTTGCTAAACTGGGGCCGCAAAGGATCAATGTGGCCGAC
AATGTTCGGCCTGGCGTGCTGTGCCATGGAGATGATGCAAGCGGCCGCTCCACGTTACGA
TATCGATCGGTTTGGCGTACTGTTCCGTGCTTCCCCCCGGCAGACGGATTTCATCATTGT
GGCCGGCACGCTGACGAACAAGATGGCACCGGCGCTACGCAAAATTTACGACCAAATGCC
CGAACCAAGGTGGGTTATTTCGATGGGCAGTTGCGCCAACGGTGGCGGCTACTATCACTA
CTCGTACTCGGTGGTGCGTGGCTGCGATCGGATCATACCGGTCGATATCTACGTTCCAGG
ATGTCCACCGACGGCCGAGGCACTAATATACGGAGTGCTCCAATTGCAGAAGAAAGTTAA
ACGCATGAAAACGGTACAAATGTGGTATCGCAAGTAG
GTATGCGATGTTTCTCGTTAAGT
AGAAGTGTTTTTTAAATGTAAGTGTTAGAGTTAACTGATATTAACATTTTGGTACTCGGG
AAAGTGTGAGTTAGTAGGGAATCGCATATGGAAACTATCGCATCATGTTTGAAA
GTTCAA
AAAGATACTCACAAACAAACACCAACCCTCCCGGACATGATGAGGCAATATTTGGGGAAG
CTAAATATAGCATGTTTAGATAAACTCCAACCGTGCCGTGCACATGCGTCCTTCTCTTTG
TGTGTCATTCGTTAAAGTTTATTTGCACCTGAACTTCAAGGACGGTGCGCACATTTCGAA
CAAATGCAATGGAATTACGATAACTGAGGTTAGTAGGTGATAATAGCAGATAAAAATTGG
CATTCCTCCTTATGAAACTTCAAGAGTTGAAGAGTTTTATGCATTGATCTTTAACCATCG
AACGACTTAAAAAAGCATTTGTAATCTAAAATGTAATTCCTTCTGACACACTTTTCTGAC
TATTCCTATTCCTTACTGTATTCCAGCAGTTTCGAATTCTGTGGTAACGTGTATGAGTAT
TCGCTTACATTTATAGTTAGTAATATTATATGTGTCGTCTATCTTTCTAATCACTGCATG
TGTAAGCCTTCGAACGTATTATTAAAAATTCAATAAACGGAACATTAATATTACGTATAA
TAAAGTGCTTTCTTTACCCGATTCTTTCATATTTTGGCCTGACCGATTTGGCATTCTATG
TATTAGGTATATGTATGGAACCAGATAACATATCAAATGTAATGTATGGTGGTATAGAAT
ACAGACAAGAAAACACAAATAATTCTGATGTCGTTTTGTAACGCAAATCAAACAAAGCAA
AACTTAACCAATCAAAACCAACTCCCAAAACATATCCGATGCTTATCGAACCGGCTTTAG
TACTTGTACTTGAAGTTCATCTTGAACAGATACTGACAGTTCACCTGTCCCACGTCGTAC
ACGATGAACTCATTGTA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004