login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG12810
Organism Drosophila melanogaster
Gene Name CG12810
Product ATP synthase epsilon chain (ATPE) (By similarity)
GENE MAP
Chromosome 3R
Citogenetic Map 85F11--85F12
Gene Map
Comment This record is derived from the following: AE003685 CG12810|FBgn0040541|CT31936|FBan0012810 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function This is the smallest of the 5 chains of the enzymatic component (Coupling Factor CF(1)) of the mitochondrial ATPase complex.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex V: F0/F1 ATP synthase
EXTERNAL RESOURCES
GO GO:0005753
Cellular component: proton-transporting ATP synthase complex (sensu Eukarya).
SwissProt AC  --
FLYBASE FBgn0040541
View Sequence REFERENCE SEQUENCE
Scaffold AE003685
Sequence Location  --
Sequence Lenght 2880bp
Relative Gene location 1528 .. 1722
CDS
CDS Location 1528 .. 1722
Sequence Lenght 64aa
Translation MKAWRDLGITYIQYSNIAARVVREALRIELRADAAKRNISHVKFTPWVNGKPVPRKKVER
ESES
mRNA
mRNA Location 1528 .. 1722
5'UTR Location  --
3'UTR Location  --
Exon 1528..1722
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGAAAGCCTGGAGAGATCTGGGTATTACCTATATCCAGTATTCCAACATCGCAGCCCGT
GTGGTGCGAGAGGCCCTGCGCATTGAGCTCCGTGCAGACGCCGCCAAGCGAAACATCAGC
CATGTGAAGTTCACTCCGTGGGTGAACGGAAAGCCTGTGCCGCGCAAGAAGGTAGAACGT
GAATCCGAATCTTAG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TAAACCACATTTTGTAAAAGCTCTTTAGTTTGCGGCATTGTCGACTGCATTTTTGGTCAT
TTGACGATTTCCTTTTGGTAATGGCACATCTTTAGATAAAAGTGCGTACTCCACGTCCAT
GTGTCTTATGAATGGAGATGCCAGCATCTTGGTGGCCAGCTCAGGATCCTCGTCGTCAAA
AGCTTTGAGTAGGTTTTGTAATGTGTTCACCTCCTGGGGATCACAACGGTTTCCCCATTT
CTTGAAGGTCTTCTTGGCATCCACGTAATCCTCTAGTGTTAATTGTACCAGTATTAAAGC
AACTACTAAACGGCCAACTTGTCCGTAAGACTTTGTCTGCAGATTTAGGCTTATTTCCTT
TTTGAGGGCTTTCGTGGCTTCTTCATATTTTTTGAGTCTGACCAATATCCGGGAAACCTT
CGATGCAAATTCCGATGCCTGATGAGTGGAGTCCCCAATCAAGACGACTGCCAGGGCGCG
TTTGTAAAATCCCAAAGCCAAGTCAGGATGCTTGGATTCCGTCATTTTGGCGGCTTTATC
GAGAGCAGCAGCTGCTGCTTCCGGCGAACCATGTTGCTGGTAGAGACAGCAAGCCCTATT
GGCATAGTCCTCCACTTCGGACAGTTTGTCCGTTTCTTTGGCAAGCAGGATAATCTGCTC
GTAGGATTTGGCTGCATGGAACCATGACTTGTTGTTTTCGTAACAGTCGATGGCCTTCAA
AAGACAATCCTTGCGCTTATCGAAACTTTTGGCAATTCGATATGCGGTTGCTGCCTTGAA
ATACATACCAGCTTTGGCATACTCATTCGCGGCACTATCCGTCTGTCCTATCAAGGCCTC
CGCCTCTTCTATCTTTTTGGCATCAAGAGTGCTCATAGTGCTAAGTTACAACCTTTGCGT
GTTGAAAAAATCAATTCAAGTGACTTATATTCAAATAAGTGTGCCCAAGTGCGCAAGTGC
CGAGAAAAACACAAAAGGCCGCTCCTTTTCTATGCGGGTATGACACTGGTATTATGGTAA
TATTAAGTGCTTTACTAAAGTTGCATAAAATATATATTTGTATTTAATTAAATAAATGCA
TACCATATAATATGCGAGCTTGGGGGGTGAAAAGTAAGCTATATTTACATTTCATGTAAG
CTGGATTTTGAATATATTTAAAAAATTGTATCGATTTGGTTTCAAATCGAACTTTTATCG
CATCCATAGAACTCCTAGTTCGATTAAGTTTGTAGCCCTGTCTGGATAAAAAAAAAACAT
CGATAAAAAGACACGTGCTTTGCCTTAAAAGATCTTAAAGTGAGGAGGTAGCAAGGCGCT
TTGATTTAACTTACTTTGATATTGTAACTTAATGCAATTAAATATTAACATAGGCTTTAC
CAATCGTGTGCGAAATCTTGAAAAGAAACCCGTCGCTCGGTTTTATATCGAATTCTTAAC
GGAAGAAGGTAAGATCCTTTATATGCAGATAGCTTTTTTTGACTTATTATCCTAACATCT
TTATAGTTAATCCCATATTACTGCAAGATGAAAGCCTGGAGAGATCTGGGTATTACCTAT
ATCCAGTATTCCAACATCGCAGCCCGTGTGGTGCGAGAGGCCCTGCGCATTGAGCTCCGT
GCAGACGCCGCCAAGCGAAACATCAGCCATGTGAAGTTCACTCCGTGGGTGAACGGAAAG
CCTGTGCCGCGCAAGAAGGTAGAACGTGAATCCGAATCTTAG
GCGCCCATTTCGGTGATT
TGTACACCATGTTTCATCCAGAATAACAGCTGCCATGATTCTACAATAACATTTCAAATA
AATCTAATTCACTGAAAAAATGATGTATATTAGATTTTTTGTTGGGTCAAAACTTCATAG
CTCATTCTTCTAAAGTACAACACAGTTCTGTATTTAAATATCATATAAATAATAATATAC
ACAACATTTAGCATACATTCTACACACGCGTATCAAATACATAGATTGTGACTGCTTAAT
TTAGACTAAGACACTAAATAGGAGAATCTAAGAATGAGAAAACAGTCAGTTCTGGAGCAC
GAGCCACGGTAGCAGGATGATGCACAAGGACCAGGATAAGCCCATCGATCCACTCTTCAA
GTTGGTATAACTGTCCACGATGTGAATCTTCCAGCCCATATTGCCATGGGTAAAGGAGTT
GTAGTACACAGTATCCGGCCATGTGATATTCGGTGTAATTTCCAATAGAGCCGGTTCCCC
TTCTACACACTCGGTGATGAGGGATCGATTGAACTTCTTGAAAGTGGGGAAGTTATCATC
CAGTCGACGATCACTATTTTGAGGATATCTGGACAGGCACAGGGGACCAGCAGCCGTGGG
CTTGGGCCTGCCTCTCCGGGTGAATTCAACACCGGCTAATACACGAATCTCACTCTGCTT
TGCATCAGACAGTCGGTCATACCCACCCTGGGGATCATCGGTGATAACCAACGGATGATA
GTGCTCCGGCGAGTGAGGATTATTGCCACCCCTAACCTTAAAGGTGTAGGTCAGACCACG
CTTTAGGTAAAGCTCTGGAATCATGTAGCCGTTGATGTACCAGGCCAAGCCACTGGACAC
ATGATTCGTCAATCCCTGATAGCCACGAAGTCCTCCAGAGGGTCCCAAGTAGGCGTTGAA
TGTGCGTACCGTTCTGCAAAACAAGGAACTATATTAAATTTTCATTGCAGGAAGATTGGA
GTCTTACGCATCTGTTATCCTGGTTCGCTCCCACACTGGAGGATTAGTCGTCTCCGCTCG
TTTTGTAAATGCAAAGCAATCATTAACCGGTTCTGTGGTGTTAAAATCTATCACTATATC
GCTCTTGGGATAGTAAGTGTGAAAGGCGGGCTCGTTGTTGGAGTCCAATGGGCCAAATGC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004