login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG9032
Organism Drosophila melanogaster
Gene Name sun (CG9032)
Product ATP synthase epsilon chain (ATPE) (By similarity)
GENE MAP
Chromosome X
Citogenetic Map 13F12
Gene Map
Comment This record is derived from the following: AE003500 RE19513.complete AY071158 RH48911.complete AY071744 RE41240.5prime BI243566 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function This is the smallest of the 5 chains of the enzymatic component (Coupling Factor CF(1)) of the mitochondrial ATPase complex.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex V: F0/F1 ATP synthase
EXTERNAL RESOURCES
GO GO:0005753
Cellular component: proton-transporting ATP synthase complex (sensu Eukarya).
SwissProt AC  --
FLYBASE FBgn0040875
View Sequence REFERENCE SEQUENCE
Scaffold AE003500
Sequence Location  --
Sequence Lenght 3898bp
Relative Gene location 1238 .. 2852
CDS
Alt Form CDS 1
CDS Location 1314 .. 2499
Sequence Lenght 61aa
Translation MTAWRAAGITYIQYSNIAARILRESLKTGLRADAAKRDASHVKFTPWANGKPAQRQTQSE
S
mRNA
Alt Form mRNA 1
mRNA Location 1238 .. 2852
5'UTR Location 1238..1313
3'UTR Location 2500..2852
Exon 1238..1342,1461..1592,2474..2852
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
TGACCGGATTCAGAAAGGGAATATCTTATATATTTTTTGTGTAGCGTGAATATATTTCGA
ATAAACCGATCACAAT
GACTGCCTGGAGAGCTGCCGGAATTACGTTACATCCAATACTCC
AACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACGGGACTGCGTGCGGATGCCGCC
AAGCGCGACGCGAGCCATGTGAAGTTCACTCCCTGGGCAAATGGCAAGCCAGCTCGT
CGT
CAAACCCAATCGGAATCCTAGAT
GCTTTTCAGTGGCCACTCGAGAATGATTCGCAACAAC
TAAGATCCGCCGAAGCTGCAATGTTGTAAAATCATGAAAAATAAATAAAATTAAATAAAT
GTAATTTATTTAAACACGATGATTTTAATTGTTCTTAAATGTGGCATTTATTTGGGCGTT
CCGTTTAGAGATCGCGACCGATGAAACGGACTTCTAGCAAAGATTTAAATATAGACTCAA
TAGAATATTGTAATTTTGAAAAGAACTATTGGTCAGGTTCACCAGAAGCCTTTTAATTGG
GATCAGTGATAGGTTTCTTGCTATAATTTTGTCAACGCATATTTGTATAGAATGATTTTA
TACACATAATGCTGAA
mRNA
Alt Form mRNA 2
mRNA Location 1238 .. 2852
5'UTR Location 1238..1313
3'UTR Location 2145..2180,2474..2852
Exon 1238..1342,1461..1592,2131..2180,2474..2852
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
TGACCGGATTCAGAAAGGGAATATCTTATATATTTTTTGTGTAGCGTGAATATATTTCGA
ATAAACCGATCACAAT
GACTGCCTGGAGAGCTGCCGGAATTACGTTACATCCAATACTCC
AACATCGCCGCTCGCATTTTGCGCGAGTCCTTGAAGACGGGACTGCGTGCGGATGCCGCC
AAGCGCGACGCGAGCCATGTGAAGTTCACTCCCTGGGCAAATGGCAAGCCAGCTCGT
GAA
AGGGCTTAGGT
GTTCCATCGTCAAATTAATAATTTAAAAACTGGCGTCGTCAAACCCAAT
CGGAATCCTAGATGCTTTTCAGTGGCCACTCGAGAATGATTCGCAACAACTAAGATCCGC
CGAAGCTGCAATGTTGTAAAATCATGAAAAATAAATAAAATTAAATAAATGTAATTTATT
TAAACACGATGATTTTAATTGTTCTTAAATGTGGCATTTATTTGGGCGTTCCGTTTAGAG
ATCGCGACCGATGAAACGGACTTCTAGCAAAGATTTAAATATAGACTCAATAGAATATTG
TAATTTTGAAAAGAACTATTGGTCAGGTTCACCAGAAGCCTTTTAATTGGGATCAGTGAT
AGGTTTCTTGCTATAATTTTGTCAACGCATATTTGTATAGAATGATTTTATACACATAAT
GCTGAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TTCGCAATGCATACGAAAAACATCTTACTGAATTTTCCTCCTCTTTTAGATCAAAGACAA
AATAGTAAAGGCGGTTCTGGACGATGCTGTTCGACAAATTGCTCTATTTTGTAACTAAAT
TATTATATAATAGCGTAATATTTAAACTAATTTGCATTAAAAGAAAAAAGAAAAAAAAAA
AAACACCCACAACCGAAATAAAAACAAATATGAATGTATAAATTACATTTTTGTGCAGTC
AGAAGTATATTTATTAAACTATAATAATGTATGTCTGGATCAACAAGGCGCTTTGTTTCA
ACTATTAATGTACATACAATATATATTTTATATATATACCACACAGGAATTCATGAGCAT
GTGCAAAATGCGTATACTCTGTATTAAAGTTGCTAGACTGCATATTTATAACATGTAATA
TACGAATACAATGCTAATTGCTTTTAGAAACCGGACTTGTTAACCTAATTAGAGAATGGG
TAATTACAACACTTATTTCAAATATGTCGAAAATATTGAAAACTAATTATGTGCAAGAAT
AAGTAATTTTCCCATTGCGTTCTGCTTTTAAGTGTGCGTCTACCGAAAAACTAAATAAAA
TCAGCAATTACTTGTCAGATCGATTCTTTAATGCGTTAAAGAATATTAAAGAAATTTTTG
TTCTGTATATATACACATTTAATTAGAACTTAAGTGTTTTCTTCTGTTAAGTTTTAAAAT
ATTATCTGTAAAGTCTAACTTAAAGTCAATGATAAATAAATAATCTAATATATCCTTAGC
TTATCCTATTTTGGGTGCATTGGTGGTTATTTGATTAATTAGCCTAGAACTAAAAACATT
TCAAGGAAAATTGGGGAATATTTTTTTTAAGTTGATGGTTTAATGTAACAATTTTTCTTG
AAATGCTTTATGCAAGGCACGTTAAACAATGTCTGCTTAATTATTTGTGTAGGCATGAAT
AAGTAACAAGCTTCGTTCTTTCGAATAAAACAGTTTGGCATATCCATATTTATTAGGGTT
TTTCCCAAAGGAAGAAAAATAAGTAAATTAGATTTTTAAATATTGAAAAGTTTGAGTTTG
GATATCGATAACAAATGTTACTAACAGTGTGTATGTTCAATAACAGAAGTCACAGTCGTC
GTCGCTATCTTGACGCGCGTAAGCTAGTATTTAAGGTATATGTGCGACAATCGACGGTAT
ATTTCTGACTTAACTCTCAAAAACTAGTTGGCCACACTGACCGGATTCAGAAAGGGAATA
TCTTATATATTTTTTGTGTAGCGTGAATATATTTCGAATAAACCGATCACAATGACTGCC
TGGAGAGCTGCCGGAATTACGTAAGCATTGTATAAGTGCCTGCCACACCAGCTGTGTTGT
GGCAGCATTCTCATGCAAATAAAAACGCCTTTGCTGCCCGATTACATAACATAATTAATC
CAAATATTACCGATTGCAGCTACATCCAATACTCCAACATCGCCGCTCGCATTTTGCGCG
AGTCCTTGAAGACGGGACTGCGTGCGGATGCCGCCAAGCGCGACGCGAGCCATGTGAAGT
TCACTCCCTGGGCAAATGGCAAGCCAGCTCGTACGTATCATAATACTTTAGACGGCCAAA
TAGCAGCCATTATATAAATTAACTCCGGATAATTCGAAATCCAAGGGGAAACCGTTATCA
ATGTGTTATTAGGAATGTTTCGAAGTCATCCACAAGTGGTTTCCACACGGTATTCTACCC
AAAAGTTTCGGAAAAAAGCCCCGTTTCGAAATGGCAATGTGAAAAATACCGAAAAATGAA
CGGTTCACTCGTGTTCCCACTTTACTCCGAAAATGTTGCCAATTTACAGGCGTAATATCG
CGTGTAAAAACTGTTCCCATCTATAGATATTCGTATATTATTGCATATATCATATATATT
TGCAATCTGTTTAAATCCTGATCATCAACATTGAAGCGTTCATACTCATCCAAACCATTT
CTAAAACTTTAATTTCAAAATTTTCGTAACTTATTGGAATATCGAAACAAAATTAGGCAA
AATTGCTTACCATTCCTTCAAGACAAACGCTCCATAAAGTAATAGAATTTATGTTTCATA
TTGCGTCATATTTGAATATATTTTTCAGATGAAAGGGCTTAGGTGTTCCATCGTCAAATT
AATAATTTAAAAACTGGCGTAAGTGCCTGCCGCGGCAGACAAAACCCAAATTATCCCAGC
GTTCGCATTAAACTCAACGACAGTTTATGTATCTAACTTTGTTCCCAAAGTTTCTAACTA
CGCTTACAAGCTGATCTGCATGCAAATGCGATGTGTTTACATATAATATAATGTTTATAT
TAATATACATATATATATCCCAAAATTGCCCGCCCCAAAAGTTTACAAGCGACCAACTAT
TAACTATTTCTTTGTGATGAAAAACTATTATCCAAAGCAAATGCTGATTATTGCCATTTT
TCTGTCCGCAGAGCGTCAAACCCAATCGGAATCCTAGATGCTTTTCAGTGGCCACTCGAG
AATGATTCGCAACAACTAAGATCCGCCGAAGCTGCAATGTTGTAAAATCATGAAAAATAA
ATAAAATTAAATAAATGTAATTTATTTAAACACGATGATTTTAATTGTTCTTAAATGTGG
CATTTATTTGGGCGTTCCGTTTAGAGATCGCGACCGATGAAACGGACTTCTAGCAAAGAT
TTAAATATAGACTCAATAGAATATTGTAATTTTGAAAAGAACTATTGGTCAGGTTCACCA
GAAGCCTTTTAATTGGGATCAGTGATAGGTTTCTTGCTATAATTTTGTCAACGCATATTT
GTATAGAATGATTTTATACACATAATGCTGAACCAATTGAATTGTTACTTATATTTTGCG
CTTTAAATATACACATATAGACATTATTTATGTTAATTATTATCCAGTTAGTTTATATTT
TAATTTAAATATATATATATATATATTTTTAAGGTAGAGTATTTTGGATTATCCTTCAAA
AATTATCGATTTGCTACCACTAAGACCGATTAAATTGCTACCGAAGTGCTATTTCAATTG
CAGCATGTTGATTTGTGTGTTGATGATGTCGTGTACTTGCGTTTCCTATGTCATCGGGTG
CGATCCTTCAATGGTTGGCGAGATTGCATTTCCCATCTTAGATCATAAGTCCTTTAGAAT
GGCACTCTTTGCGTTTTTCAACTTATCGAGGCGTTTCAACAAATGGTTGTTGGACGTTTC
AGCTTCCTCCAACTTCTCCAAGAGTTCCCGGTGCTGCGAAATGGATTAGCTAGATCATAA
ACTGCTCATTTCGCTTGGCATTCCCACCACTCACCTCGCGTTGCAGCTTGCGGCGCTCCA
GCTTCAGCTCAGCCTCCGCCTTTTCGGCAGCTTCTGCGGTGCTTTTGTATCGGATTACTT
GAGTTTCGGAGCGCGCTAGGCTCGACTGTAGGTTGGCGATTTCCTGTTCCGCCTTTTGCA
GCTTATATTTATGGTCTGAAATGATTTTGTTTGTTTCCCCTGTCGGATAGTATAAGAAAA
AGGAAGGGCTCGTAATATAGTACAAATATGTTGCAGTCCTATAGTGCCAAACTGCAATAG
TTATATACAATTTATTGTTTTAAAAAACTGAAGATATATGGAGATACACAAAAGTGCGAG
AGAATGTGGCCGATCAATGCGATCGGAAATATAAATGATATATATATATATATATATTGC
TTGAAGCCATGTTATCAAATAATAAAAACTACAAATAATACGATTTGAATATCGTTCAAA
TTTGAGCAAGACTCGGTTAGTTATTGTGTGCTGCCAAAAAGGGCTGCTAGTTATAAAAAA
GATAATCACTGCGGTGCACTTTACATGCTGAAAGTTTAGTTGGCATTAAGTAAGTATG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004