login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG2014
Organism Drosophila pseudoobscura
Gene Name Dpse\CG2014
Product NADH-ubiquinone oxidoreductase 20 kDa subunit (NUKM) (By similarity)
GENE MAP
Chromosome pseudo2-mel3R
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig143_Contig447 (WGS as of 2003 08 28) The following contributed to reference sequence development: bases 1..2580 - Contig143_Contig447 413124..410545
PRODUCT
Function Unknown
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0016655
Molecular function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as
SwissProt AC  --
HGSC (Dpseudoobscura) Contig143_Contig447
View Sequence REFERENCE SEQUENCE
Contig Contig143_Contig447
Sequence Location 413124..410545
Sequence Lenght 2580bp
Relative Gene location 864 .. 1499
CDS
CDS Location 864 .. 1499
Sequence Lenght 211aa
Translation MFGSLKMYKNAVMLLPRGPAVGSLWIREQKTMPVYDDVRQKPAKRGYSPFGRNQNSWSEW
TLARLDDLLNWGRKGSLWPMTFGLACCAVEMMHIAAPRYDMDRFGMVFRASPRQTDVMIV
AGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVPG
CPPTAEALLYGLLQLQKKVRRMRTLQMWYRK
mRNA
mRNA Location 864 .. 1499
5'UTR Location  --
3'UTR Location  --
Exon 864..1499
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGTTTGGATCCCTCAAAATGTATAAGAATGCAGTGATGCTGCTGCCCCGTGGACCGGCT
GTCGGCTCTCTCTGGATTCGTGAGCAGAAGACCATGCCGGTGTACGATGACGTCCGCCAG
AAGCCGGCCAAGCGGGGCTACTCTCCTTTCGGACGGAACCAGAACTCCTGGTCGGAGTGG
ACGCTGGCCCGACTGGACGATCTGCTGAACTGGGGCCGCAAGGGGTCCCTGTGGCCGATG
ACCTTTGGCCTGGCCTGCTGTGCCGTCGAAATGATGCACATTGCAGCCCCTCGCTACGAC
ATGGACCGCTTTGGCATGGTCTTTCGCGCCTCGCCCCGTCAGACGGACGTGATGATCGTG
GCCGGAACGCTGACCAACAAGATGGCGCCGGCCCTGCGCAAGGTGTACGACCAAATGCCG
GAGCCGCGTTGGGTCATCTCGATGGGGAGCTGTGCCAACGGCGGCGGGTACTACCACTAC
TCCTACTCCGTGGTGCGCGGCTGCGACCGGATTGTCCCAGTGGATATCTACGTGCCTGGA
TGTCCGCCCACTGCCGAGGCCCTGCTGTACGGCCTTCTGCAGTTGCAGAAGAAGGTGCGC
CGCATGCGCACCCTTCAGATGTGGTACCGCAAGTAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TCCGCGCGGATCCATCTGCTCCAAGGTAGCGGGGGCTGCTGCTGCAATCAGCTAATAATT
TCCTTTAAAAGATCTCGCTGGGACGGGATTGGGATGGGATGCTGTATGAATGGATGCTTC
ATGCGTATTTATGAGTCTAACGATTCCTGTTCGCTGTCCGCCCAGGCCCAGGGCCTCTGA
GTGTTCAAGTTTTTGGATTGATTTTAACGCCGAATGGTTGTAGATATTTACAATGTATAG
GTGTTCATTATAATGGTGATCAGGGGACAAAGAAGGAGAGGAGATACTTAGAAAGAATTT
TAATTACAAGTTCACATTTTTGATGATTCTAGAGATGGGCAGGGCTTCCTGGCAGTTCTA
GTATTCCACTAGACTTGAGTGTGAATTTAGCTCACTAGTATTTTTTTGAGACCACCTGGA
GACCTAATGGAAATGATTAACATGAAACATTAATTACTAGACGATAATTGCAGCGCCTTT
TTCAATATTAGTTTGGAGAACTTGGTTTTTTTTCATGTGGCCACTGTATGAGTAATATCG
ATAGCGTAGTCGATATTTTTGGAGCTTTTGATTTCCGGCCCTAAAAAAGAAGGGGTTCGA
GCCCATCTCTAGTTCTGTGTGATTGGAAAAATTAGGAAAAGGAAAGTTATTTATAATAGT
AGGCTGTGAATGATAGTCCAGACAACCTAGTGACCTTTAAAACGACTCAATCGATTCGTA
TCTATCTATTCTCACAAATCTGTGTTCCGTACGCAGGGAAACCCCAGTCAAACTTGTAAC
AAATAACGCAAGCAGTAAAATGTAAGAGAATTCTTTCAAAGTCCCGACTAAATAACAAAT
TTTTACTTTCAATATCCAGCAGAATGTTTGGATCCCTCAAAATGTATAAGAATGCAGTGA
TGCTGCTGCCCCGTGGACCGGCTGTCGGCTCTCTCTGGATTCGTGAGCAGAAGACCATGC
CGGTGTACGATGACGTCCGCCAGAAGCCGGCCAAGCGGGGCTACTCTCCTTTCGGACGGA
ACCAGAACTCCTGGTCGGAGTGGACGCTGGCCCGACTGGACGATCTGCTGAACTGGGGCC
GCAAGGGGTCCCTGTGGCCGATGACCTTTGGCCTGGCCTGCTGTGCCGTCGAAATGATGC
ACATTGCAGCCCCTCGCTACGACATGGACCGCTTTGGCATGGTCTTTCGCGCCTCGCCCC
GTCAGACGGACGTGATGATCGTGGCCGGAACGCTGACCAACAAGATGGCGCCGGCCCTGC
GCAAGGTGTACGACCAAATGCCGGAGCCGCGTTGGGTCATCTCGATGGGGAGCTGTGCCA
ACGGCGGCGGGTACTACCACTACTCCTACTCCGTGGTGCGCGGCTGCGACCGGATTGTCC
CAGTGGATATCTACGTGCCTGGATGTCCGCCCACTGCCGAGGCCCTGCTGTACGGCCTTC
TGCAGTTGCAGAAGAAGGTGCGCCGCATGCGCACCCTTCAGATGTGGTACCGCAAGTAA
A
CCGATCGAATTTAGTTTTAGTCGTGTAAAAGATCATCTCAAATAAAGGCCATGTTCAAAG
TTGTCTTGGTCTCAGCTCGGGCTGATCTTCTTGGCCGAAACAAAGTCAAAGAGTTAAGCG
CATCAGTTCCAGAATCTCGAGATCTGCTTAGTCATAGGGAGCAGCCTATAGTCGGCTCGT
GCGCTCACCTACACTTGAAGAGGATCAGTCGCAGACGTGGAACTGGAATGGACAAGAGAT
CTGGCGACAATAGACACTTCTGGCCACTCTCAAGTGTCTCTGACTTTGTGACATGATGAA
ATATGAAGGGTTCTTGAAACATATGAAAGGATTTTGTTGTTCTCGTAACAAAACCGAAAA
TCCTTTTTGCGAATTCGCCGACACCGAGTACTTGAACTTGATGGGAACATCATTAAATCC
TCTCTCCCTCGGTCGATCTCTCGAGTGCGAGTGCGGTGAGTGCATTAAATTGCCGGGCTG
GGCTGGACACAGGACAACAAGCGCATTAGTGTAATCCATTTGGGACACACCCACAGCCCG
GCAGAGCTGCGAGGTGAATGGAAACTCTCGAGGCATGAATGAAGGGCCACATTCATTGAG
CGAGAGAAAAGGACGAGCCTGGGCAGGCAGGACCCGGCACTTGATGTTCGAGGGGTTGCA
GACAAAAGCGCAGCAGGTCGCTGCGCAGGTCCTCGGATCATGGGAATCCGTGACGCAGCC
AAGACAGGCCGAGGCACCCGTTTCTCCAGAATAAGAACGGACACAAAATTAACTTGTCTC
AATCGCACAGCAATAAAAATTAATAATAAAGCCAGTGGCAACATGTTCGACTCCATTGTG
AGGCATTAAATAAATTTAACAGCTCAATGACTTGTCGAAAGGTGGAGAAATCGGACCGCA
ACGGGGGTGTGGGACGGAGACAGAGACGGAGGACCAGTGGATCCAGTGAAGCGTACGGGC
TCAGACATCCATATCTTAATTAGCAGACCCGGGCTTACATTAACCTTAATTTCGGAGTGT
GTATGTTTTTTTTTTGTTGTATTTTTATTCTGGTTTAAACTTTAACTTTAATGATTTCTA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004