login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG6463
Organism Drosophila melanogaster
Gene Name CG6463
Product NADH-ubiquinone oxidoreductase 13 kDa-B subunit (NUFM) (By similarity)
GENE MAP
Chromosome 3L
Citogenetic Map 67E7
Gene Map
Comment This record is derived from the following: AE003547 >RH11203.complete AY070675 >gb|AY070675|AY070675 RH11203 full length length cDNA. The following contributed to reference sequence development: bases 1..3300 == AE003547 84900..88199
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. This is a component of the iron-sulfur (IP) fragment of the enzyme.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
SwissProt AC  --
FLYBASE FBgn0036100
View Sequence REFERENCE SEQUENCE
Scaffold AE003547
Sequence Location 84900..88199
Sequence Lenght 3300bp
Relative Gene location 954 .. 1877
P-insertion P{EPgy2}CG6463-EY07792
CDS
CDS Location 1043 .. 1745
Sequence Lenght 124aa
Translation MAKIIKASTGLTGLAVSTNPHHTLSALYGKILRAVSKMPQDASYRKYTEQLVKQRADSVA
QHKDITALEKAVGCGQVEELIVQAENELILARKMLGWKPWEKLVQAAPAKQWDWPPAQIM
EPKV
mRNA
mRNA Location 954 .. 1877
5'UTR Location 954..1042
3'UTR Location 1746..1877
Exon 954..1063,1193..1354,1554..1877
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CTCGACACTTCACAGCACTGGGCAACAGCTGTTACAAAATAAAGTCGTGCGGAAAATTAA
GCATTTTCGGCTAAAAGTCTATTGCAAAC
ATGGCCAAGATCATTAAGGCGTCCACAGGTT
TGACTGGACTCGCCGTGTCCACCAATCCACACCACACGCTGAGTGCTCTGTATGGCAAGA
TTCTGCGGGCGGTGTCCAAGATGCCACAGGACGCCAGCTACCGCAAGTACACGGAGCAAC
TGGTCAAGCAGCGCGCCGATTCTGTGGCCCAA
CACAAGGACATCACTGCCCTGGAAAAGG
CCGTCGGTTGCGGTCAAGTGGAGGAGCTAATTGTCCAGGCCGAGAACGAGCTGATCCTTG
CGCGCAAAATGCTCGGCTGGAAGCCCTGGGAGAAGTTGGTCCAAGCCGCGCCTGCCAAGC
AGTGGGACTGGCCACCAGCCCAGATCATGGAGCCCAAGGTTTAG
ATTCACACTTAGTACT
AATTAATCTACAGCAAATCGAAATGAGAAGAGAGCAATAAATCCGTTGATAAGCCAGTGG
CTTTATCAGCTAAAAAATAATTGAGCTTTAATCAAATGAATAAACCTGGAACAGCA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
AGTCTGCTGTTCATCTCACTCAGCATTATATTCCAGGTAAATTTCTATAGGTGCAAATAA
TGCATATATTTGTAAAATCAAGCTTAAATATCCAATGAACGCAAGATTTGATAAGTAAAT
TCCACACATGTATAACTTACATTTCTAAACTATCAGAATATTCTTAAGATGATAAGAAAA
TTCATTAAAAACAAATATATACAAAGTAATCAAAGGTTTTAGCCCATTTATTGTAGTATA
AAAACAAAGTAGTTTATCTTAACCAGATTTCACTGTTTTGCTTAATAACCATATTTTTGA
TGACACACACTCATAATTTCTTTGTCATTTCAGATTGCTGTGGGCGTGGGCCTTATATTG
AATGGCCAGTATAACATCAAAAACGGTCACGATATCTGCCGGGCGAACAGGATCAATAAT
TATACAGTTAGCGGCATTTTTATAGTCACTGTGGTCAATGTTCTAATATCAGCCTTTACT
GTGGACAGAGATACTGTGCCTGCTTTACCCGCCAATACAACATAGTTTAACTTGTATTTT
AAATAGACTTTAGTATTATGAACACACAGATGCATCTTTAGATAATACTCACATTGTTCA
AACCTTGTTAAATTTCACTCAGCGACTCATTTTTCTAAACGCAACAATGAATTGTGATAA
ATAAAATCCCACGAGCATTTCTCGCTTATTTAAATAACTGAAATGCTGTTTTTCTTACTT
TTGGGCGTTTTAAGTAAGAAATGAATAAACTTTCTTAAATGTTATAAGATACGTTCACAT
TAATATTAAATACTTATAAACCAGTTGTTCTTTGGATATTCTTTGTTATTAATATTAAAT
TCTAATAACTCAAATGCAATTCTATTTATACTATTTAAATCAATTTTTGGCGCCAAACTA
TCGTTTAGTTGCGATAGTTTACGTAGTGGCATTTCACAGCACTGTGTTATAGCCTCGACA
CTTCACAGCACTGGGCAACAGCTGTTACAAAATAAAGTCGTGCGGAAAATTAAGCATTTT
CGGCTAAAAGTCTATTGCAAAC
ATGGCCAAGATCATTAAGGCGGTAAGTTCAAGGAACTC
AAGTGAAGCACCTGCTCGAGAACCTACAAAAGAGAAATGACCGACTAATCCCCGCTTGAG
TTTCGCGGCGTTTCTTCAATTGTTATTGTTATGTCATCGCTTCCTTCTGCAGTCCACAGG
TTTGACTGGACTCGCCGTGTCCACCAATCCACACCACACGCTGAGTGCTCTGTATGGCAA
GATTCTGCGGGCGGTGTCCAAGATGCCACAGGACGCCAGCTACCGCAAGTACACGGAGCA
ACTGGTCAAGCAGCGCGCCGATTCTGTGGCCCAA
GTAAGATTATTTGGAAACTTTGCTAA
TTTGGGTTTACCAAGTGGATGGTACCTTCATCAAAGCATATGTAGCACCTATATAGACCG
TGCAACCAAGATACAGATCCTTACACTTGTTATTTGTATTAAAGACTGTTATTTTCTTGA
TCATCCTCCAATTTCCTTTTTTTTAATACAATCTCTAACTTTCTCACCCGCAGCACAAGG
ACATCACTGCCCTGGAAAAGGCCGTCGGTTGCGGTCAAGTGGAGGAGCTAATTGTCCAGG
CCGAGAACGAGCTGATCCTTGCGCGCAAAATGCTCGGCTGGAAGCCCTGGGAGAAGTTGG
TCCAAGCCGCGCCTGCCAAGCAGTGGGACTGGCCACCAGCCCAGATCATGGAGCCCAAGG
TTTAG
ATTCACACTTAGTACTAATTAATCTACAGCAAATCGAAATGAGAAGAGAGCAATA
AATCCGTTGATAAGCCAGTGGCTTTATCAGCTAAAAAATAATTGAGCTTTAATCAAATGA
ATAAACCTGGAACAGCA
CCACAAGATCAGCCACATTCAAGCAATCGATCCACTGACGATC
TCAGTTCGTTTTCAACATGCGTGCGCTTCAGTACCTTCTGCTACTGCTCGTCATCTCCAT
CGGCTTGGCGGCATCGGTGCCTCGCCAGCGTCGTCAGATCGATCTCACGGTTTCGGCGGA
GCACGACGACAACGATGAGGAGACGGAACTGGCTCTGGAGGCCATCGCCGGGCTATGGAG
CAGTGCGGACAGTCGGACGAAGATCGATGGCTCTGCCAGCCTGGTGCATCGAACACATGG
AACACAATCGGGTACGGGCAGCACCAGATACCAGGCCAAACTGCATCTACACCATGACTA
TAAGACCAATGCGTATCCCTCGTAATCCAAGGTTCGGAGCAGGACTTTCGCGTGGGCGTG
CGTATTACATTCGACAAATAGAGCCGTGAGAATTCCAGACATCAGCAGGCGGGCGGCCGG
GGACAAAATCGAGCGATTGCGTGAGGAGACAGACGGCCACTGTATAAACAATCCCACTGA
CGATAGATAACATTTTGACCTTCTCGGGCTTGGCTTTGTTGGAAATATATATAGAACGTT
TGTGAAAATACAATATACCCGCATAATGTTCGCTTTATTGATTCCATTTTAATCGCCCTC
TCCGGTTTTCTCGACCGTGAAGCGGCGCGCAACAAATTTCAGCTTAAAATTACAACTAGA
ACAACGAATTTGCACAACAATGATGAGGTGGACAGGAGGAGAGTATATAATAAATACAAG
CCATTTCTTAAGTATAAATGCCATTAGTCAAAGTGGTTTGCAGGGTGGGGGCTCCAGGCA
TCGGGGTCACGAAAAGTAATCTATGGTCTACTTTCATTGGAAACATTGGGTCAAGTTCGC
TGGCTAAGCAATTGTTTACTAACAATATTCTGCTGCTGACAAAGTATTTTTCACAATATA
AGCAAAGTTTGTCCTAGAATTCAAAAATAGTCTGCTTCTACATAAAACTAAAATCTTGAT
ATTGCTCTTATATATGCGATTATTGAATGGAGAGTATTATTTCTATTTTATTTAAGAAAA
CTATTAGTTAAAATATGAAGTTTGATATTCTGTATCTTCGGAAAGTTTTTAAGTTTCTCT
TATAAGCTAAATTCTTTACAATATGCATAAAGAGTACCTGGTTTTCCTATAGCTTCCTGC
CGTTTCCAATGATAAGTTTTCTATAATTTACTTTTCCTGTCGTCGATCAGTTCACAAACA
ATTTCTACCCCCACCCCATTGAGGTTAATATCATTCTACATTCGTCCGCAAAATGCTTCG
CCTTAATTCAAGTTAACTGATACTCCCTGCTTCTGCTGCTCCTTGAGTTCCTGGACGACA
AAGTTGCGGAATTCCTCGTAGGCCACATCGATGTCCACGTTATTGATGATCTTGTGGAAG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004