login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_2968
Organism Drosophila melanogaster
Gene Name CG2968
Product ATP synthase delta chain (ATPD) (By similarity)
GENE MAP
Chromosome X
Citogenetic Map 9B4
Gene Map
Comment This record is derived from the following: AE003449 RE24457.complete AY071203 GH27338.3prime AI514250 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Produces ATP from ADP in the presence of a proton gradient across the membrane.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex V: F0/F1 ATP synthase
EXTERNAL RESOURCES
GO GO:0005753
Cellular component: proton-transporting ATP synthase complex (sensu Eukarya).
SwissProt AC  --
FLYBASE FBgn0030184
View Sequence REFERENCE SEQUENCE
Scaffold AE003450
Sequence Location  --
Sequence Lenght 4020bp
Relative Gene location 1658 .. 2962
P-insertion P{GT1}BG00301
CDS
CDS Location 1125 .. 1607
Sequence Lenght 160aa
Translation MSFALRSARLAALARPSIRMVQSRGYADEMAFTLAAANKVFYDSANIRQVDVPSFSGAFG
ILPKHVPTLAVLKPGVVTVYENDGAVKKIFVSSGTVTVNEDASVQVLAEEAHPVEDLDSS
ACRELLSNAQTQLSSASGDKDRAEAAIAMEVAEALVKASE
mRNA
mRNA Location 1020 .. 1915
5'UTR Location 1020..1124
3'UTR Location 1608..1674,1748..1915
Exon 1020..1674,1748..1915
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATCTGCATTGTTTCGTTTCTATTTCCAATTGGAATTTGTTGTTGTGCTGCCTGTGCCAGT
GTGACCAGGTAGCGCGGTGGCTAAAAATAGTCGCTAACGCCAGTT
TTGAATGTTGCGCGG
GTAAAAGATTCGTGAGATACGAAAAAACTCCGAACTTTAATAAAAGGATCTAATAAAAAA
GGAAATACTGAAAAAGAAACTAAACAAAATCAAAAACACCAGATTCATAACAGTATAAAT
GGTCGCATGGTTATGCCATGTAAACACACCGTTATTAATCAAAGTCTTAATCTAATAAAG
GAAATTTCATTTTTTAAATTATAATTTTTGGAATAAATAGTTTTTCTTTTAATATCATTT
TTAATGTACGATCAAAAGCAATATACAAAAAATTTAAGCTTTTAATTGGCGATGCCAGAC
TAATGAATTAAAAGAATAAGTGTTGCCACTAAAAGTTTATTGGTCTATATAATTTGTTTA
TTGATTGAGGCACTTTATTATTATAATTAAAACACTTAATTATTATGTGTGAAATGATTG
CACTTTTTATTTTGTAAGAGCCTGTTGCGTATTGAAAATTTTGTATTT
TGTCTTGTCCTC
TAAATATCGTAAAAACGCGTTATTGCTAGATAAGTTTTGTATTCCCGGCTGGTCA
GAAAT
AAAAACAGGTGAAAATAACTGATAAATTGAGGGGTAGTCCACTGATCACAGTGCCCGAGG
ATTTGCAATGAAAAGCGATCGAAATTTGAGCTGGGGAAACGCAATAGCAGCCGCCGCCTA
ACCTACAAAGTTACATAATTTGGTTATTTTGTTGTTATGCTGG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GGATGACAAGAAAACCTACATATAATTTTGCCTGAATCAGATAGTACGAAGGGTATACAC
TTTTCGAAGTATCTAAAAGTACCGTAACAAAAAACAAAAGGAGCAGAAGATGAAAGCGAA
GAAGCAAAAAGAGGAGCAACGACCCAACATTGTTGTTGTCTTATGCCGCTGCTTCTTTGC
GATGTTGCCGTTCCGCTCGCACCGCTATAGCTTGGGGTCAATAGCTAAGGATCGGATCTG
TTGTATATATGTTTATATAGACCGATTGCGGTTAGTTCTCTTATCAGAAATAACATGAAA
TATATTGCGTTGCGACGCCACTGGCGACCGCGACGCAGGCAGAGGGCAAGACAGCGGAGA
AGAGAGTGAGTGAGAGTGTGACGGCGGAGAGAGAGGTAAACAAAAATACACAAACACATA
CACATGCGCGCTACAGCTGCTCGTTCACATGTGTATGCGGGCCTGTATGTGTGCAACAAA
CAAAAAGCAGAAAATCCTTCTCTTCTTCACACCCTTTTTCCACAACAAAGTCAGCTGTGT
GTGTGAGGAATGAACTTTAAGGCAAGCTTTCTGTTTCTATTTTTTGCAGAGTTTTTCCAA
CTGAAAGGCGCAATTTGCTAAGACACCTATACACATACACGAAGAGCCAAGCAAAATAGA
AGATATAACAAAACAAAATAGAAAATAAGCAGAGCGAAAAATATATAGACAGCTATCTAT
GCACACAAACACAAACATGGGGAAACACTGTTGTTTTTCGCAACTGCGTTTCGCCTGCAG
GTGCGACAGAGAGGGCGCGAGTGGGTGACAAACTTGGGTAAATGTTGCAAGCACTTACGT
CCTGTGTGTTTTGTTTGTTTGTTTGTTTGCTTGTCGCCTTTCGCTGTCGTTCGCCAACAA
ACACCTCAGCGCAGAGCACACACGCGACACGCACACACTCACACACAGTCACAGAGACGT
GCACAAATAGCAGCCGAAAATGGCACTCTCTTCTTCTTCACTTGTATAATAATGCAGCAA
TCTGCATTGTTTCGTTTCTATTTCCAATTGGAATTTGTTGTTGTGCTGCCTGTGCCAGTG
TGACCAGGTAGCGCGGTGGCTAAAAATAGTCGCTAACGCCAGTT
TTGAATGTTGCGCGGG
TAAAAGATTCGTGAGATACGAAAAAACTCCGAACTTTAATAAAAGGATCTAATAAAAAAG
GAAATACTGAAAAAGAAACTAAACAAAATCAAAAACACCAGATTCATAACAGTATAAATG
GTCGCATGGTTATGCCATGTAAACACACCGTTATTAATCAAAGTCTTAATCTAATAAAGG
AAATTTCATTTTTTAAATTATAATTTTTGGAATAAATAGTTTTTCTTTTAATATCATTTT
TAATGTACGATCAAAAGCAATATACAAAAAATTTAAGCTTTTAATTGGCGATGCCAGACT
AATGAATTAAAAGAATAAGTGTTGCCACTAAAAGTTTATTGGTCTATATAATTTGTTTAT
TGATTGAGGCACTTTATTATTATAATTAAAACACTTAATTATTATGTGTGAAATGATTGC
ACTTTTTATTTTGTAAGAGCCTGTTGCGTATTGAAAATTTTGTATTT
TGTCTTGTCCTCT
AAATATCGTAAAAACGCGTTATTGCTAGATAAGTTTTGTATTCCCGGCTGGTCA
CTCTGA
CTTAAACGTTTTTCGCAAAAACAGCGGCTGATCACTGAAGTTTTCTCGTGTTTTTCGCTA
TCAAACCGAAATAAAAACAGGTGAAAATAACTGATAAATTGAGGGGTAGTCCACTGATCA
CAGTGCCCGAGGATTTGCAATGAAAAGCGATCGAAATTTGAGCTGGGGAAACGCAATAGC
AGCCGCCGCCTAACCTACAAAGTTACATAATTTGGTTATTTTGTTGTTATGCTGG
CTGGC
TGTGGCAGAAAAGACTTTTAATCCTGAATTTATCCTCTCGTTGCAGCCCAAAATGTCCTT
CGTTAAGAACGCCCGTTTGCTGGCCGCCCGCGGCGCTCGCTTGGCCCAGAACCGCAGCTA
CTCGGATGAGATGAAGCTGACCTTCGCCGCCGCCAACAAAACCTTCTACGATGCCGCTGT
GGTGCGCCAAATCGATGTGCCTTCCTTCTCGGGATCCTTCGGCATCCTGGCCAAGCACGT
GCCCACTCTGGGTAAGTTCGATCATTCAGTTTCAGTTGCCTCGAGATGGTTATATCACCG
TTGGCGAATCTCTTTGCTATTGCAGCTGTCCTGAAGCCCGGCGTTGTCCAGGTGGTGGAA
AACGATGGCAAGACCCTCAAGTTCTTCGTCTCCAGCGGTTCCGTCACCGTCAACGAGGAT
TCCTCCGTTCAGGTTCTGGCCGAGGAGGCCCACAACATCGAGGACATCGATGCCAATGAG
GCGCGCCAGCTGCTCGCGAAATACCAGTCACAGCTTAGCTCCGCTGGCGACGACAAGGTG
CGAATCTAGTCAAGAAGTTGCATAGTAGAGTAGTGTCTAGAAAGTAGAAGTAGTGGTCCA
GAAAGTACAACTCAAACAGACTCTTTTGATGGAAACACTGCTTCCACCATTCACGCCAAC
TGGCATTTAAGTTACTAAACGATTTCTATGTGCCCATCCTTTTTACTTGATATACTTTCT
TTGTACAAACAAGTTTGCTCTTAAATTAACGCTTACACATTCGATATTTCCATGAGTAAA
CTTATGTTTGAGTTGCTTTTGCATTCTGTATTGCACATTCTGAAGCTATCTAAACGAGAC
TTAACCACGATCCTTGTTTTGCAGGCCAAGGCCCAGGCTGCCATTGCCGTGGAGGTCGCC
GAAGCGTTAGTCAAGGCTGCCGAATAGACGTAATCACCACACAACCGCCACCAATAAACC
ACAATCGATGCTTTGTGTCTGAAATAAATAAAAAACATAACGATCACCTTAAAAAGCCAG
AGAGTTATGAAACAATAAAAAAGCGAATCATAATATCGTATTAATGACCCGTGATCCACC
AGGCAAATGATTTTTTTTTCTTTTTTTTTTCATGTTATGCCGCTAAACTGTGTGTTTATA
TAGTTTATAATATATGTATGTGAGCTGGTGAAGAGAAATGTGTAATATTTGCTCGCTGTG
GGATAGACCGTTGATATGATAATGCTTTGGCAATCTTTAAGTCAAAAATATGAGTGATTT
GCATTTTGGCCGAAAGAGACGAACGTCGTTTCTTTTTCCCTTGCCAATTTATGCAAATCG
CATAAGCATAAAAACTTACAATTTGTAAATGAGCTCGTCTTTCATCTTAACAAATAGTAT
AGTTTGTATTTCATCTGGTGTGTTGCATTCATGGATAGTTCGCATATCTTATCTCGGATG
ATTGTTTAAATTTCTCTCAAAAGTAGTAATAAAAAGCAACTTTGTTTTTTTTTTATGGAA
ACAAGAATTAATCAATGGCTAAAATTATACTTTTGGCAGATAGAAGATAATCCATTTTGA
AACTCTTTATAAAGATGATAAATACTATAGAATTGAAAAAAGAAAATTGGATTTTTTTTT
TTTGGAATTGTCTATGTATTTGGTAACAAAAAAATGTGTTGTAAAAAAAATGTCTTAAAT
TAACTCATGGCGTTGTGTGGGAATGGTAATATGCTGTCGATGTAGTTAGCAGGAAGGTCC
TCCGATAGATTGGCGAATTGTTCTAGTATCCCGGTGGGCCGTAGGTCTGGGCAGGGGCGT
GACCGATGGGCAGGGACTGCTCCTCGGGAGCAAAAACGGGTGCAGGAGCGGGATGTGGCA
CACTCAGGACGGGAGCGGGTGCTGGGGCGGCATAGACTGGAGCTGGGGCAGGAGCGGAGT
AAACTGGAGCGGGAGCAGGAGCGGAGTAAGCTGGAGCGGGAGCAGGTGCGGAGTACACTG
GAGCGGGAGCAGGAGCAGAGTACACAGGAGCTGGGGCAGGAGCGGAGTACACTGGAGCGG
GAGCAGGTGCGGAGTACACAGGAGCGGGAGCAGGAGCAGCATAAACTGGAGCCGGAGCTG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004