login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG7610
Organism Drosophila melanogaster
Gene Name ATPsyn-gamma
Product ATP synthase gamma chain (ATPG) (By similarity)
GENE MAP
Chromosome 3R
Citogenetic Map 99B10
Gene Map
Comment This record is derived from the following: AE003771 RE35715.5prime BI239268 RE35715.3prime RE74140.5prime BI580019 RH12342.5prime BI608164 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Produces ATP from ADP in the presence of a proton gradient across the membrane. The gamma chain is believed to be important in regulating ATPase activity and the flow of protons through the CF(0) complex.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex V: F0/F1 ATP synthase
EXTERNAL RESOURCES
GO GO:0005753
Cellular component: proton-transporting ATP synthase complex (sensu Eukarya).
SwissProt AC  --
FLYBASE FBgn0020235
View Sequence REFERENCE SEQUENCE
Scaffold AE003771
Sequence Location  --
Sequence Lenght 3240bp
Relative Gene location 942 .. 2363
P-insertion P{EPgy2}ATPsyn-gammaEY03351
CDS
CDS Location 1331 .. 2224
Sequence Lenght 297aa
Translation MMMQRTQLLLPLAMEATMLAQQQRGMATLKMISIRLKSVKNIQKITQSMKMVSAAKYARA
ERDLKAARPYGIGAQQFFEKTEIQPDEKAEPKKLLIAVTSDRGLCGAVHTGVARLIRGEL
AQDEANTKVFCVGDKSRAILSRLYGKNILMVANEVGRLPPTFLDASKIANEVLQTGYDYT
EGKIVYNRFKSVVSYQCSTLPIFSGSTVEKSEKLAVYDSLDSDVVKSYLEFSLASLIFYT
MKEGACSEQSSRMTAMDNASKNAGEMIDKLTLTFNRTRQAVITRELIEIISGAAALT
mRNA
mRNA Location 942 .. 2363
5'UTR Location 942..1254,1309..1330
3'UTR Location 2225..2363
Exon 942..1254,1309..2363
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GGCAAACCTCTTAATCCTTATCAATTATTATTCTGTTTTTAACTCTATTGTCATAATTAT
GAGTTACATAAATTCAAATTAATTTCAAGCTTTATTGTGCATTCTGAAGCTTTCCAAAGA
AGTTTTGTATTTTATCCAATATTAATAGTTATATGTAGCACAAATCCATTATCCGAAATT
TCCATAATTAAAATAAATTATTTAATATAATATTTTACCGTTCACCACGAATCGCCACCG
CGTTAACCCGAACTGGGTGGCAACTCTGCTCGGTGTTATAACACTCGTTGTGGCGCAGCC
AACTTAACGCAAG
GGAATCTTCGACAACTCACAGGATGATGATGCAACGCACCCAGCTCC
TGCTGCCCCTGGCCATGGAGGCCACCATGCTGGCCCAGCAGCAGCGTGGCATGGCCACCC
TGAAGATGATTTCCATCCGCCTGAAGTCGGTGAAGAACATTCAGAAAATTACGCAATCGA
TGAAGATGGTGTCCGCTGCCAAGTACGCTCGTGCCGAGCGAGACTTGAAGGCGGCTCGTC
CTTACGGCATCGGCGCCCAGCAGTTCTTCGAGAAGACGGAGATCCAGCCGGACGAGAAGG
CGGAGCCCAAGAAGCTGCTCATCGCAGTGACTTCGGACCGTGGTCTTTGCGGTGCCGTCC
ACACTGGTGTGGCCCGTCTCATTCGCGGCGAACTGGCCCAGGACGAGGCCAACACTAAGG
TGTTCTGCGTGGGCGACAAGTCGCGCGCGATTCTGTCCCGTCTGTACGGCAAGAACATCC
TGATGGTGGCCAACGAGGTGGGCCGACTGCCCCCCACTTTCCTGGACGCCTCGAAGATTG
CCAACGAGGTTCTGCAGACCGGTTACGATTACACCGAGGGCAAGATCGTGTACAACCGTT
TCAAGTCGGTGGTGTCCTACCAGTGCTCCACCCTCCCCATCTTCAGCGGATCCACCGTGG
AGAAGTCGGAGAAGCTGGCCGTCTACGACTCGCTCGACAGCGACGTGGTCAAGAGCTATC
TGGAGTTCTCGCTGGCCTCGCTCATCTTCTACACCATGAAGGAGGGCGCCTGCTCGGAGC
AGTCCTCCCGTATGACTGCCATGGACAACGCTTCCAAGAACGCCGGTGAGATGATCGACA
AGCTGACCCTCACCTTCAACCGTACCCGACAGGCGGTCATCACTCGCGAGCTGATTGAAA
TCATCTCCGGTGCCGCCGCCCTCACATAA
GCGAATGGAATGTGTTCGAACAGCTCTAACG
ATTCATACAGCTAATTGCATATGGTGCCAGGCACCTGGAGCTACGCCTGGAGCCCTAGTA
ATGTTACTCTTTCAGAAAAACCCCAGAATAAATAGCGTGGAACGAACG
CDS
CDS Location 1331 .. 2224
Sequence Lenght 297aa
Translation MMMQRTQLLLPLAMEATMLAQQQRGMATLKMISIRLKSVKNIQKITQSMKMVSAAKYARA
ERDLKAARPYGIGAQQFFEKTEIQPDEKAEPKKLLIAVTSDRGLCGAVHTGVARLIRGEL
AQDEANTKVFCVGDKSRAILSRLYGKNILMVANEVGRLPPTFLDASKIANEVLQTGYDYT
EGKIVYNRFKSVVSYQCSTLPIFSGSTVEKSEKLAVYDSLDSDVVKSYLEFSLASLIFYT
MKEGACSEQSSRMTAMDNASKNAGEMIDKLTLTFNRTRQAVITRELIEIISGAAALT
mRNA
mRNA Location 942 .. 2363
5'UTR Location 942..1330
3'UTR Location 2225..2363
Exon 942..2363
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GGCAAACCTCTTAATCCTTATCAATTATTATTCTGTTTTTAACTCTATTGTCATAATTAT
GAGTTACATAAATTCAAATTAATTTCAAGCTTTATTGTGCATTCTGAAGCTTTCCAAAGA
AGTTTTGTATTTTATCCAATATTAATAGTTATATGTAGCACAAATCCATTATCCGAAATT
TCCATAATTAAAATAAATTATTTAATATAATATTTTACCGTTCACCACGAATCGCCACCG
CGTTAACCCGAACTGGGTGGCAACTCTGCTCGGTGTTATAACACTCGTTGTGGCGCAGCC
AACTTAACGCAAGGTAGGTGAATTTTCTCAATTTTTGCCGAGTGAATCGAGCTAATTTTC
GCGACAGGGAATCTTCGACAACTCACAGG
ATGATGATGCAACGCACCCAGCTCCTGCTGC
CCCTGGCCATGGAGGCCACCATGCTGGCCCAGCAGCAGCGTGGCATGGCCACCCTGAAGA
TGATTTCCATCCGCCTGAAGTCGGTGAAGAACATTCAGAAAATTACGCAATCGATGAAGA
TGGTGTCCGCTGCCAAGTACGCTCGTGCCGAGCGAGACTTGAAGGCGGCTCGTCCTTACG
GCATCGGCGCCCAGCAGTTCTTCGAGAAGACGGAGATCCAGCCGGACGAGAAGGCGGAGC
CCAAGAAGCTGCTCATCGCAGTGACTTCGGACCGTGGTCTTTGCGGTGCCGTCCACACTG
GTGTGGCCCGTCTCATTCGCGGCGAACTGGCCCAGGACGAGGCCAACACTAAGGTGTTCT
GCGTGGGCGACAAGTCGCGCGCGATTCTGTCCCGTCTGTACGGCAAGAACATCCTGATGG
TGGCCAACGAGGTGGGCCGACTGCCCCCCACTTTCCTGGACGCCTCGAAGATTGCCAACG
AGGTTCTGCAGACCGGTTACGATTACACCGAGGGCAAGATCGTGTACAACCGTTTCAAGT
CGGTGGTGTCCTACCAGTGCTCCACCCTCCCCATCTTCAGCGGATCCACCGTGGAGAAGT
CGGAGAAGCTGGCCGTCTACGACTCGCTCGACAGCGACGTGGTCAAGAGCTATCTGGAGT
TCTCGCTGGCCTCGCTCATCTTCTACACCATGAAGGAGGGCGCCTGCTCGGAGCAGTCCT
CCCGTATGACTGCCATGGACAACGCTTCCAAGAACGCCGGTGAGATGATCGACAAGCTGA
CCCTCACCTTCAACCGTACCCGACAGGCGGTCATCACTCGCGAGCTGATTGAAATCATCT
CCGGTGCCGCCGCCCTCACATAA
GCGAATGGAATGTGTTCGAACAGCTCTAACGATTCAT
ACAGCTAATTGCATATGGTGCCAGGCACCTGGAGCTACGCCTGGAGCCCTAGTAATGTTA
CTCTTTCAGAAAAACCCCAGAATAAATAGCGTGGAACGAACG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GCCTCGGTGGCCACGTACAACATCTTGTCCGTTTCCAGCGAGTCCAGATACTGCAGGATG
CTGGGGTGACGCAATGTCTTGAGGCGCTTCAGCGCCGCCTTGGCCAGCTCGCACTTGGTG
TCGGATCCGCTACGGATGTCGTAGACGAACACAGACACCTCCTCCAGCGTCGTCTTGCGC
TTGGCCTTGTGCAGCGTCCATATGGAGTATTGGTCAAAGCCGCCCACCGGTTCGCCAATG
TCGTAGGGGAAGTCTTTCGAGGAGTCGCGCGAGAAGAACGACCACATTATGTGTTTTGCT
CGGCGGCTCAATATTTTGTTACTGTTGTGTCACACAGCAACAGCAACAACAACAGCAACA
ACTGGCGATTGCAACTGCAACAACAACGCACTGCGCAGGCAACACACGCACGCACACACG
CACGCACGCACTCACACACACGCACACCTTGTTGCTGCCACACAAAGGCACTGAAATCGG
TGGAGCCCCGATTCTCGGTTTATCCTCAAGCACTATGCCTCTGTCTTTAGCCTTGGCTTG
AGCCCTATCCTCCTCATGCCAATCCAGCCGCCTGATGTCCTTTATTTTCCTCCGATGCGC
AGCAACAATTTTCCAGCTTTGCTTACGCACACACACACGCACACAGCTAACTTATCCGCT
GTTTTTCGTCCCCAGAGGTCTCATCCCTGGGATCCCGGGTGTCCTGGACAGGGCGATCGT
GTCTATGTGGCTCTGCTGCGGGTCGGGGGAGTCAGTAGATCGGATCGGGCGCTCGTCTCC
GTCGAATTATCCTAATCTTTTTCCCGAGTACGTCAGCTTTTTTTTGCGTGAGGCGTTAGT
GACGGAACTTCGTGGCTCGTGCGTGAGCAGCTGATTCCAAAACAGAGCTGGCAAGGAGAA
GGAAAACTCTGGTCGAGGGTAGAAAACAAGCTGGCATCTTTGGCAAACCTCTTAATCCTT
ATCAATTATTATTCTGTTTTTAACTCTATTGTCATAATTATGAGTTACATAAATTCAAAT
TAATTTCAAGCTTTATTGTGCATTCTGAAGCTTTCCAAAGAAGTTTTGTATTTTATCCAA
TATTAATAGTTATATGTAGCACAAATCCATTATCCGAAATTTCCATAATTAAAATAAATT
ATTTAATATAATATTTTACCGTTCACCACGAATCGCCACCGCGTTAACCCGAACTGGGTG
GCAACTCTGCTCGGTGTTATAACACTCGTTGTGGCGCAGCCAACTTAACGCAAGGTAGGT
GAATTTTCTCAATTTTTGCCGAGTGAATCGAGCTAATTTTCGCGACAGGGAATCTTCGAC
AACTCACAGGATGATGATGCAACGCACCCAGCTCCTGCTGCCCCTGGCCATGGAGGCCAC
CATGCTGGCCCAGCAGCAGCGTGGCATGGCCACCCTGAAGATGATTTCCATCCGCCTGAA
GTCGGTGAAGAACATTCAGAAAATTACGCAATCGATGAAGATGGTGTCCGCTGCCAAGTA
CGCTCGTGCCGAGCGAGACTTGAAGGCGGCTCGTCCTTACGGCATCGGCGCCCAGCAGTT
CTTCGAGAAGACGGAGATCCAGCCGGACGAGAAGGCGGAGCCCAAGAAGCTGCTCATCGC
AGTGACTTCGGACCGTGGTCTTTGCGGTGCCGTCCACACTGGTGTGGCCCGTCTCATTCG
CGGCGAACTGGCCCAGGACGAGGCCAACACTAAGGTGTTCTGCGTGGGCGACAAGTCGCG
CGCGATTCTGTCCCGTCTGTACGGCAAGAACATCCTGATGGTGGCCAACGAGGTGGGCCG
ACTGCCCCCCACTTTCCTGGACGCCTCGAAGATTGCCAACGAGGTTCTGCAGACCGGTTA
CGATTACACCGAGGGCAAGATCGTGTACAACCGTTTCAAGTCGGTGGTGTCCTACCAGTG
CTCCACCCTCCCCATCTTCAGCGGATCCACCGTGGAGAAGTCGGAGAAGCTGGCCGTCTA
CGACTCGCTCGACAGCGACGTGGTCAAGAGCTATCTGGAGTTCTCGCTGGCCTCGCTCAT
CTTCTACACCATGAAGGAGGGCGCCTGCTCGGAGCAGTCCTCCCGTATGACTGCCATGGA
CAACGCTTCCAAGAACGCCGGTGAGATGATCGACAAGCTGACCCTCACCTTCAACCGTAC
CCGACAGGCGGTCATCACTCGCGAGCTGATTGAAATCATCTCCGGTGCCGCCGCCCTCAC
ATAAGCGAATGGAATGTGTTCGAACAGCTCTAACGATTCATACAGCTAATTGCATATGGT
GCCAGGCACCTGGAGCTACGCCTGGAGCCCTAGTAATGTTACTCTTTCAGAAAAACCCCA
GAATAAATAGCGTGGAACGAACGAAAATAACTTTAACCATGGAGTCCTTACCTAATTGGA
GTGGGAGGCAAGGAATTTGAAAGCACTTGCACAGGTCTGTTTGGTTTTTACACATTGATA
TCATGGGATTCGATTGCATTCTTATGCAAAGACCCATTGATATAACTTAATGTGCATAAA
GTCTCAAATTTCAAGTGGCAATGACTAATGACCAAAAAACTATTGGAACGTTTATGTATA
TTTTGATACTCTTTAAACTTTCAGAAATTGGTGGTATCTACACTTTGTGCTTATCTATGG
AATTAAGGCGTGGGATTTCAATGGGATGCTTCTTCGTTGCCTAGCACATATTCTGCAGCA
CATTCAGTATGTAGGCTCCAATGTCCTCGTCCTGGTTGGTCCACGATATCAAAATGTTCT
TCTGCTTGGGATCCTTCTCGTCCTCCTCCACCTTCACCTCAACGGATTCGATGGCTATGG
AGCCGTTCTCCTGCATCGTCACCGTCCAGCCGGCTAGCTTTTCTTCGAGCAGAGTCTTCA
GTCTTTCGCTTGTGCGAATGACCGGTCCGGAGTCGTCCATTTTGACCTTGGATGTAAATC
GCATAACATGTCGATTAATTCCGATTTCCTTCAGGGCATCGGTTAGGTTTTGCAGCATTA
TTCGATTGTCCTTCATTACGAGGACGCCATGGATTAGTCGCCGCCTCTTGGGATCCGGTG
GCTGGGCGTTGTAGGACCGGGCCTCTGCTTTAAGCAGGGAAACGGACGCATCTACTGGTA
TCTTCACAGGCGTAGAAATCACACAGGTTTCGCCGTTGGCCGGCATGTAGGTTTCCAGGT
TGAATTCGTCTTTGATCTTCGAGCGCAGGAACTTCATCTTCCCTGCTTCACCATGGACGA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004