login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG2014
Organism Drosophila melanogaster
Gene Name CG2014
Product NADH-ubiquinone oxidoreductase 20 kDa subunit (NUKM) (By similarity)
GENE MAP
Chromosome 3R
Citogenetic Map 99B2
Gene Map
Comment This record is derived from the following: AE003770 CG2014|FBgn0039669|CT6471|FBan0002014 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Unknown
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0016655
Molecular function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as
SwissProt AC  --
FLYBASE FBgn0039669
View Sequence REFERENCE SEQUENCE
Scaffold AE003770
Sequence Location  --
Sequence Lenght 2700bp
Relative Gene location 1113 .. 1651
CDS
CDS Location 1113 .. 1651
Sequence Lenght 212aa
Translation MISFLKLARNPGQLLLPGSGVLQSQWLRGQKTMPVYDYRCQNPPKWGYSAFGRNQKTWGE
WTCARLDDLLNWGRKGSLWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRASPRQADVLI
VAGTLTNKMAPAFRKIYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIVPVDIYVP
GCPPTAEALMYGILQLQKKVKRMRTLQMWYRK
mRNA
mRNA Location 1113 .. 1651
5'UTR Location  --
3'UTR Location  --
Exon 1113..1651
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CGGTGTACGATTACCGTTGCCAAAATCCGCCAAAGTGGGGCTACTCGGCCTTCGGACGCA
ACCAGAAGACCTGGGGCGAGTGGACCTGTGCCAGGTTGGATGACCTGCTAAACTGGGGAC
GCAAGGGATCCCTCTGGCCGCTGACCTTTGGTCTCGCCTGCTGCGCCGTCGAAATGATGC
ACATTGCGGCTCCTCGCTACGACATGGATCGCTACGGTGTGGTGTTCCGAGCATCTCCTC
GCCAGGCGGACGTGCTCATCGTGGCCGGAACCCTGACCAACAAGATGGCACCGGCCTTTC
GGAAGATCTACGACCAGATGCCCGAGCCGAGATGGGTCATTTCCATGGGCAGTTGCGCCA
ATGGTGGCGGCTACTACCACTACTCCTACTCGGTGGTTCGCGGCTGCGATCGCATTGTTC
CGGTGGACATCTACGTGCCCGGATGTCCGCCCACCGCCGAGGCCTTAATGTACGGAATCC
TGCAGCTGCAGAAGAAGGTAAAGCGCATGAGGACCCTGCAGATGTGGTACAGGAAGTAG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
CGCTTGACAATATGGATGATTTAGTAGTCGCTGCCGTTTGGTTGTCGTGTCTGAGGCACC
ATAGGCGTAATTAGACAAGCATTGTGCAAAAGCGTTAATTAAAAACCACAGAGACACACA
GCCAGTTGCCATTTTTCCACCGACTATTGACTGCCAGCTGCGCCAGCGCCACGACTTCAA
TCTCACACTAGGAGATACATTTGCAGCAGCCACAAAACTGTAGAAGTTCACTGCTCATTT
GCTCTAAAAACTATAAGATACATTTCGGAAAAAATGTAACTATATTGAACAGTTTATGAA
AAGTTACTACAAGATACAGTTTAAAACTGGTCAGCTTCATTTTACAGACTTTGCTTTAGA
ATCTACCCTTTAAAGTGCACAGTTTTTTTTTAATATGATTTACTTACAATTTCTTTCATT
TAATGTAGAATGTATTCCTTTGCCAAAAGATCTTTTTTTTGCAAGTGCAGCTCCGCGGTG
TCGATTCCGTAATGAGCCAGCGCATCGATTGCGTAAGTTCTCCGCGGATGCATCTGCTCC
CAGTTTCCAGGGCCCATTCCCATTCCCATCTCTCGAGTTGCATGTCCCCAGGTCCTCGAG
TCCCATTAGTGCACCCGTGCAGCGGGGATGTGGATGGTGATGGCGCTGCAGCAATCAGCT
AATAATTTCCTCCTAAGCGATCTGTACTCAAGCATCCATGGCGCATGAATGGGAGCTCCA
TGCTCATGCGTATTTATGAGCTTCATGGATTCCTGTTCGCTGTCCGCCCAGCGTTGAGTG
CCTGGGATTTCGGATTGATTTTGACGCCAATCGGTGGCGTCAGGGGAATCCAAATGGGAT
TTACAAGAGCTTATATACATTGTAGAAGCCAAAGTGTTAAAAATGTTACATAGCTCAGCC
TCAGAAAAAGTTGTCAAACCTTCAATATAGCTAGCAATATCTAAAAGTTCAAAGTAAGTT
TTCACATTTTCCATGCATTGCTACATCGCAAAATAAATTAAGTATCTTCAGGATGATAAG
TTTCCTGAAATTGGCCAGGAATCCTGGCCAGCTGCTGCTGCCTGGCAGTGGAGTGCTGCA
ATCCCAGTGGCTTCGTGGCCAGAAGACCATGCCGGTGTACGATTACCGTTGCCAAAATCC
GCCAAAGTGGGGCTACTCGGCCTTCGGACGCAACCAGAAGACCTGGGGCGAGTGGACCTG
TGCCAGGTTGGATGACCTGCTAAACTGGGGACGCAAGGGATCCCTCTGGCCGCTGACCTT
TGGTCTCGCCTGCTGCGCCGTCGAAATGATGCACATTGCGGCTCCTCGCTACGACATGGA
TCGCTACGGTGTGGTGTTCCGAGCATCTCCTCGCCAGGCGGACGTGCTCATCGTGGCCGG
AACCCTGACCAACAAGATGGCACCGGCCTTTCGGAAGATCTACGACCAGATGCCCGAGCC
GAGATGGGTCATTTCCATGGGCAGTTGCGCCAATGGTGGCGGCTACTACCACTACTCCTA
CTCGGTGGTTCGCGGCTGCGATCGCATTGTTCCGGTGGACATCTACGTGCCCGGATGTCC
GCCCACCGCCGAGGCCTTAATGTACGGAATCCTGCAGCTGCAGAAGAAGGTAAAGCGCAT
GAGGACCCTGCAGATGTGGTACAGGAAGTAG
AGAATATTCTTGTAAGGAGTTCAGTAAAT
AAATGATACCTTGTTAAGTAAAGTGTTTTTGGGGTGGTGCAACCGATAAGTAGAGTTGGG
CTTAAATCGATCCTAACCTAATCCGATCTCTGCCTTACCCAAAACGAAGTCAAAGAGTTA
AGCGCATCAGTTCCAGCAACTACACAAGATTCCTGGCTCAGAAAGTCGCTTAGTCAGCGG
AATAGGGCTCGTGCTCACCTGCAAGGATCGGTTTCATGTCCCGCAAAGGACCTCTTGAAG
CGAGTCCTGCAGACAATGCGCGGAGACAATAAACACTTCTGACGGCACTGTCTCTCAAGT
GGCGATGAAATATGAAGGGTTCTTGAGGCATATGAAAGGATTTCGTTGTTTCACATTTTT
TCGAGCCAGCCCGAAAATCCTTTTTGCGAATCTGGCGACACCGAGCACTTGAACTTGGTG
GGAACATCATTAAATCCCCGTTCGAGTGCGGTGAGTGCATTAAATTGTGGGACAACTATC
GCATTAGTGTAATCCATGTGCGACACACCCACAAAACTGGCAGATCCTCGGCTTGAATGG
AAACTCTCGAGAGTGAAGGACTTGAATGAATGAGTATCTCCTCTCATTCAACGAGCGGCG
AGAAAAGGACCTGCACACTCTGAAAATCTGGACAAAGGCGCAGCAGGCAGCCCGCTGATC
TTCGGGGATCCTGGGAATCCTCTCGTGACTCGCACAATTCCTGCGAATAAGAATGACTGC
GTGGGGAAATTAACTTGTCTCAATCGCACAGCAATAAAAATTAATAACAAAGCCACTGGC
AACTTGTTCGCCTCCATTGTGCAGGCATTAAATAAATTTAACAGCTCAATGACTTGTCGA
AAGGTGCTGGGAGAATCCAGGGGCTCCAGGGGCTCCTGGGTTGCTGCAGAATCGAAATCA
GTGGACCGTTCGCAGCCAGGCGAGCATATCTTAATTAGCAGACCCCGGCCCACATTAACC
TTAATTTTGCTCTGTTTTATTTTACCGATTTCTGCTTAATTGCGGCGCCGAGGCGCCAAC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004