login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG11154
Organism Drosophila melanogaster
Gene Name ATPsyn-beta
Product ATP synthase beta chain (ATPB) (By similarity)
GENE MAP
Chromosome 4
Citogenetic Map 102D1
Gene Map
Comment 1075This record is derived from the following: AE003846  RE12172.5prime BI170649 GH22373.3prime AI403018 gb|X71013|DMATPSYNB mRNA for ATP synthase beta subunit  Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Produces ATP from ADP in the presence of a proton gradient across the membrane. The beta chain is the catalytic subunit.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex V: F0/F1 ATP synthase
EXTERNAL RESOURCES
GO GO:0005753
Cellular component: proton-transporting ATP synthase complex (sensu Eukarya).
GO:0005754
Cellular component: proton-transporting ATP synthase, catalytic core (sensu Eukarya).
SwissProt AC  --
FLYBASE FBgn0010217
View Sequence REFERENCE SEQUENCE
Scaffold AE003846
Sequence Location  --
Sequence Lenght 5220bp
Relative Gene location 1075 .. 4178
P-insertion P{SUPor-P}ATPsyn-betaKG07618
CDS
CDS Location 1151 .. 3674
Sequence Lenght 505aa
Translation MFALRAASKADKNLLPFLGQLSRSHAAKAAKAAAAANGKIVAVIGAVVDVQFDDNLPPIL
NALEVDNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGYPIRIPVGAETLGR
IINVIGEPIDERGPIDTDKTAAIHAEAPEFVQMSVEQEILVTGIKVVDLLAPYAKGGKIG
LFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIEGGVISLKDKTS
KVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALLG
RIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDATT
VLSRAIAELGIYPAVDPLDSTSRIMDPNIIGQEHYNVARGVQKILQDYKSLQDIIAILGM
DELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEQTIKGFSAILAGDYDHLP
EVAFYMVGPIEEVVEKADRLAKEAA
mRNA
mRNA Location 1075 .. 4178
5'UTR Location 1075..1150
3'UTR Location 3675..4178
Exon 1075..1214,2168..2479,2533..4178
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
AATATATCGCGACTACCGATTTGCTCATCACTAGGACTTCTGCTCGCCCGCACACTTCTC
AGTTAGTTCGAGAAAA
ATGTTCGCGTTACGTGCTGCATCTAAAGCCGATAAGAATTTGCT
GCCATTCTTGGGGCAATTGT
CTCGTAGCCATGCTGCCAAGGCTGCAAAGGCTGCAGCTGC
CGCAAATGGAAAGATTGTGGCCGTAATTGGTGCAGTCGTCGATGTCCAGTTTGATGATAA
CTTACCGCCCATTCTGAATGCCTTGGAAGTAGACAACCGTTCTCCTCGGCTCGTGCTAGA
GGTGGCCCAGCACTTGGGAGAAAATACCGTGCGCACTATCGCCATGGATGGTACCGAAGG
CTTGGTTCGCGGACAGAAGGTTCTCGATACTGGGTATCCTATCCGAATTCCAGTTGGTGC
CGAAACACTAGGACGCATCATTAATGTTATTG
GTGAACCCATTGATGAGCGTGGACCAAT
TGATACAGACAAGACCGCTGCCATTCATGCTGAGGCTCCTGAATTCGTTCAGATGTCTGT
TGAGCAAGAGATTCTTGTCACTGGAATCAAAGTCGTCGATCTCCTGGCTCCATACGCCAA
AGGTGGTAAAATTGGGTTGTTTGGAGGTGCCGGTGTGGGCAAAACTGTGTTGATCATGGA
GCTCATTAACAACGTGGCTAAAGCTCATGGTGGATACTCGGTTTTCGCGGGAGTTGGTGA
ACGCACTCGTGAGGGAAACGATTTATACAATGAGATGATCGAGGGTGGTGTTATTTCACT
AAAGGACAAGACCTCAAAGGTGGCTCTCGTATATGGGCAAATGAACGAGCCGCCAGGTGC
TCGTGCCCGTGTTGCTCTAACTGGACTGACCGTTGCAGAGTACTTCCGTGATCAAGAAGG
ACAGGATGTGTTGCTGTTTATCGACAACATTTTCCGATTTACTCAAGCTGGCTCAGAAGT
GTCCGCTTTGTTGGGTCGTATTCCCTCAGCCGTCGGTTACCAGCCAACCTTGGCTACCGA
CATGGGTTCTATGCAGGAGCGTATTACCACCACCAAAAAGGGATCCATTACTTCTGTTCA
GGCCATATATGTGCCCGCTGATGATTTGACCGATCCTGCTCCTGCTACTACATTCGCTCA
TTTGGATGCCACCACTGTACTCTCGCGTGCGATTGCCGAACTGGGTATTTACCCTGCTGT
GGATCCACTGGATTCGACTTCTCGAATCATGGATCCCAACATCATTGGCCAAGAACACTA
TAACGTTGCCCGTGGTGTGCAGAAAATCTTGCAAGACTACAAATCACTTCAGGATATAAT
AGCCATTCTCGGAATGGATGAGTTGTCTGAGGAAGATAAGCTCACAGTCGCTCGTGCTCG
CAAGATTCAGCGTTTCTTGTCGCAGCCATTCCAAGTTGCTGAAGTCTTCACCGGGCATGC
TGGTAAACTAGTGCCCCTGGAGCAAACTATAAAAGGTTTCTCAGCAATTCTAGCTGGGGA
CTACGACCATCTACCTGAAGTTGCTTTCTACATGGTCGGCCCAATCGAAGAAGTTGTAGA
AAAGGCTGACCGCCTGGCAAAGGAAGCTGCCTAG
ATAGGCGTACTGGAAAAATCTTCAAA
GTCAGCAAATCTATCATTGAATATTATGCATTGAATTTGTAATAAACTTTGTAAGATCAA
ATTAAATTCAATACAAGCGAAGAAAAAGTTAATAAAACCTATTTAAACATTACGGTATGA
ATTAAAAGCAAAATATTTAATGTGAAAAAGCTTCAGATTAAGTGAGTATATGGTAGTATC
ACCGTGAAATTCTACAGGTAGAATTTAAACTGACTATTAATTTCTGCATTGGTTACTTTA
TATTAAAAATTACACTATGTTATCATTTTGACTGACTGTCGAAAATAAACCAAACTATTA
ATATATTGTTTTTAATACATGAGCCGATTTCATAGACTATCAGTACCCCTTATTTTGCTA
GGCGGCAAAAAATGTTTGGTATAACGAATTTAATATACTATAGGTAGCGGGTTCTAAAAA
TATTCAACCAATAAAATGTTGACTGAAATATCAGAGATTAATATTAGTTTAAAAAGAT
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TGTTCCTCCTCCAGAAATTGGCTCCGAGGTTTTTCCTCCTGGCGGGAAAAGAGTTTTTTA
CTTATTTTCATTGAGCGTTGGGGAAATCAATGTATTGCAGAAAATGACCACACGTGGTAC
AGGTGGAAAAATACAAGGGAAATATCGATGCATCGATAACTTAAAATGATTTGAAGGAGT
AAATATTGTAGTTATGTGTTTGTAAGCGTAAACACCCCTAACCTAGATAAACTATTAGAT
TTTAGCGATGGGTAGGAAGGAAATGTTTATAGCTGTTTCTCGCTAAAATGGAAGGGCTTA
GCAAAAGTAATAAACCCTAAGTTTCCCATACCAACCAGTTTAACATAAACAAATTTATTT
TTTAGGTTTTAAAATAACGCTTTTCTTCAGGCAGACAAGCCGACAAAAATTGTATTAAGA
CAAATATCGAAAAATTTTGTTTGCTTTTGATATCTTTTAAACAAAAATTAATTGCCAATC
AGACTGACTAAGAATTGTTTACTCGCTTTTTCAACCATATCTTCTTCATCATCTTCATAT
CAGGATCACCAGCCGAGTCGATCTACACATGTCCCTCTGTATGTCGAGATCACAGGAACT
ACGAAAGCTAGATAGTGATTTAACAAGTTGAGACTTAACATTCCAGAGACGAAGAATCAG
GGCAAGTTTTTTCATCGATGCTGCAACGCACAATCTATTGCCCACACGCCGCCCAAAACT
GTCACGCCTACCACTATTAATATCATTTTTTGTCATATATTTTCCAAATTCTATCCATAA
GCCATAAAATAATTTAAATTTCTCTTGCGTACTTGCGTTCTCTCTTGTTTTACTTATTTT
TGTTGGTGCAGTTACCTCTACTCAGCCACATCAGCTTGCAATCCATTAAACCACCTTTTC
ATGGGTGTATCAGTCGTTAGTGTCGGGCAACCACAACAGTTACAGTTCATTGTGTATATA
TAAAAGTGGCATTCGGACACTCTCCTGGTGCGGTAACAACAACGTAAGTCCACATTATGG
TCTGAATACGCAAAAATACTAAAACCTCGATATGTTTTGGAAGCGTAAATACTCAATATA
TCGCGACTACCGATTTGCTCATCACTAGGACTTCTGCTCGCCCGCACACTTCTCAGTTAG
TTCGAGAAAA
ATGTTCGCGTTACGTGCTGCATCTAAAGCCGATAAGAATTTGCTGCCATT
CTTGGGGCAATTGT
GTAAGTAGCACAAAAATAAAAATTTTTAATTGATAACAATTGTATT
AAATTGCGAAGTTCAGCACAAAATATGTGCTTTGGCTAATAGCGCAATTGTCGAACATAA
CCTATCGTTCAATAAAATGTTACGAGCGAAAAAAAATATTACATAACAATTTTGAATGAT
TTAAGGTTACTTCTGTTTTATAACATATATAACAGTACTCAATTTAAACGACTTTTGAAA
AAAAAAAAGATTTTTTTAGTCAGACATTTGCGTGTACGTCTTTCTGTAAGTTAACTAGGT
ATGTACATATATTGTATGCCGATATTGTTTGACGTTTTAAATTGAATAAATTTTTTTTTC
GTTATATTGCAATTGAATTCTTCACAAAGTATTTTGAAAATTAAAGTTACTTAAAAATTA
AATTAATAATTAATAGTATAATATTAATTGTTCATCATTATCTTAAAAAATAATATTAAA
AATTGTCGATATTGATGCCCAAATTGTTACTGTTTAAGTTTTACGATGATGTATTCTACT
AGTATCACTTTCGTTAAGTATAACATAAATCTGTATATATTGGTATCTAGTGATAGGAAA
ATCAATAAACTGATAGTACTTTTTATTAAAAAATGATACCAATTAGCTTTACATATGGGG
TATTAAGAAAACCTTTTCATACGCTGGCAATATAAATTAGCAAACTTTTCCGATCCCATA
AATTTTATTCGATGATCAGGATCATCAGCCGAATGTGTTTTATTCATTCATTAAACAAAT
CAAGCATCTAATACAATGTTAGATACATATATATTTTTTTGCAAGCACCTGCTGCGGTGG
CCTTCGACAAGTCCTGATTTTTTATTTACAATTATTCTCAAGAAGTAAGCTAGTTTTCTT
TAAGTACGATTTTAAAAATATTTGAATACATTTTTTAAAACTTACTAAGCAACTGCTCCG
TTTTCAGCTCGTAGCCATGCTGCCAAGGCTGCAAAGGCTGCAGCTGCCGCAAATGGAAAG
ATTGTGGCCGTAATTGGTGCAGTCGTCGATGTCCAGTTTGATGATAACTTACCGCCCATT
CTGAATGCCTTGGAAGTAGACAACCGTTCTCCTCGGCTCGTGCTAGAGGTGGCCCAGCAC
TTGGGAGAAAATACCGTGCGCACTATCGCCATGGATGGTACCGAAGGCTTGGTTCGCGGA
CAGAAGGTTCTCGATACTGGGTATCCTATCCGAATTCCAGTTGGTGCCGAAACACTAGGA
CGCATCATTAATGTTATTG
GTAAGTAAATTATATTAAAACATAAGAAAGAAATTAAGAAA
TTCTTTGAACAGGTGAACCCATTGATGAGCGTGGACCAATTGATACAGACAAGACCGCTG
CCATTCATGCTGAGGCTCCTGAATTCGTTCAGATGTCTGTTGAGCAAGAGATTCTTGTCA
CTGGAATCAAAGTCGTCGATCTCCTGGCTCCATACGCCAAAGGTGGTAAAATTGGGTTGT
TTGGAGGTGCCGGTGTGGGCAAAACTGTGTTGATCATGGAGCTCATTAACAACGTGGCTA
AAGCTCATGGTGGATACTCGGTTTTCGCGGGAGTTGGTGAACGCACTCGTGAGGGAAACG
ATTTATACAATGAGATGATCGAGGGTGGTGTTATTTCACTAAAGGACAAGACCTCAAAGG
TGGCTCTCGTATATGGGCAAATGAACGAGCCGCCAGGTGCTCGTGCCCGTGTTGCTCTAA
CTGGACTGACCGTTGCAGAGTACTTCCGTGATCAAGAAGGACAGGATGTGTTGCTGTTTA
TCGACAACATTTTCCGATTTACTCAAGCTGGCTCAGAAGTGTCCGCTTTGTTGGGTCGTA
TTCCCTCAGCCGTCGGTTACCAGCCAACCTTGGCTACCGACATGGGTTCTATGCAGGAGC
GTATTACCACCACCAAAAAGGGATCCATTACTTCTGTTCAGGCCATATATGTGCCCGCTG
ATGATTTGACCGATCCTGCTCCTGCTACTACATTCGCTCATTTGGATGCCACCACTGTAC
TCTCGCGTGCGATTGCCGAACTGGGTATTTACCCTGCTGTGGATCCACTGGATTCGACTT
CTCGAATCATGGATCCCAACATCATTGGCCAAGAACACTATAACGTTGCCCGTGGTGTGC
AGAAAATCTTGCAAGACTACAAATCACTTCAGGATATAATAGCCATTCTCGGAATGGATG
AGTTGTCTGAGGAAGATAAGCTCACAGTCGCTCGTGCTCGCAAGATTCAGCGTTTCTTGT
CGCAGCCATTCCAAGTTGCTGAAGTCTTCACCGGGCATGCTGGTAAACTAGTGCCCCTGG
AGCAAACTATAAAAGGTTTCTCAGCAATTCTAGCTGGGGACTACGACCATCTACCTGAAG
TTGCTTTCTACATGGTCGGCCCAATCGAAGAAGTTGTAGAAAAGGCTGACCGCCTGGCAA
AGGAAGCTGCCTAG
ATAGGCGTACTGGAAAAATCTTCAAAGTCAGCAAATCTATCATTGA
ATATTATGCATTGAATTTGTAATAAACTTTGTAAGATCAAATTAAATTCAATACAAGCGA
AGAAAAAGTTAATAAAACCTATTTAAACATTACGGTATGAATTAAAAGCAAAATATTTAA
TGTGAAAAAGCTTCAGATTAAGTGAGTATATGGTAGTATCACCGTGAAATTCTACAGGTA
GAATTTAAACTGACTATTAATTTCTGCATTGGTTACTTTATATTAAAAATTACACTATGT
TATCATTTTGACTGACTGTCGAAAATAAACCAAACTATTAATATATTGTTTTTAATACAT
GAGCCGATTTCATAGACTATCAGTACCCCTTATTTTGCTAGGCGGCAAAAAATGTTTGGT
ATAACGAATTTAATATACTATAGGTAGCGGGTTCTAAAAATATTCAACCAATAAAATGTT
GACTGAAATATCAGAGATTAATATTAGTTTAAAAAGAT
AACTTAATGTTTGTTTTACTAA
ATTCCTACACGGATCGGTAGGTGAAACTGGATACTTTTGCTGTGTATTAGCACGGGCAGT
TTTTTCTTTGGACACATGGTGGTTGCACTATAAAACTATCCGGAACATCCAGTTTTGAAA
CTGTCTGTCTTCAAAAAAACAAGACTCGTAATCTAAACAACTTTTGTACATAAAAGTAGT
TGATTGGAGTTGGAGCCAGTTGATTGCAGACGTTGCCTATAGAATTAAAAAATGCACGCG
ATCAGGGGAATTGATTTTCATTTTAAGTATTTATTTGTATTTAATAAATCATATATATAG
AGTAATTTTTTTTAGTATTTGGAATTATTTGTGTAATGGACTTTGCTTAAAATTGCATTA
TGCTTTGAATTCCCTCAAAATATAAAGGACATCCACTAACAAAAAAATTTATTATAATTA
TTTGGATATACTTTGAGAAACATAAATTATTTTCGGTTATTATTTTATAGGCTTTTACCT
TAGGAGCGAAAGCTTTTCGATCAATATAATGTATCCAAAGCTTGTTCGTATAATTGTTAT
CGTGTAATTATTATTAAAATTGATTTGTGAAGACATTTAGGTCCTAAAAATTGAATTTAA
GCAACTGTATATAGACCAATAGTATTAGACAAAAAGAATCAAGTACTCTGCAAGCATTGG
TAAAGGAATTGATGAGTAATTATGGAAAACCGTGGGATGCAACTAAAGTTCAACTTATTG
TAGACCGTAGTATAATCTTTTTTACTTTAAAATATATCTGGCAAACTTTTTAAATGTGTT
TAAGTCCAAGTTTTTTTTTAACATGTACTATCAGGTAAAATGTATAATCATTTCACAATG
ATTAAGTTAAGTTACAAGTTATTTTCGCAGTTATGCTCATACCACAAAATTATTCATTTA
GTAAAAAAGAAATATAATTTTTGTTATGTTTATCATATCGCATTGTTTAAATTAGCTATT
TGCCCATAAGGTGTAAACACAATATAAAGCGAAACACAATAACCTTTGTAATTATACTTA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004