login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG11154
Organism Drosophila pseudoobscura
Gene Name Dpse\CG11154
Product ATP synthase beta chain (ATPB) (By similarity)
GENE MAP
Chromosome  --
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig6260_Contig6412 The following contributed to sequence development: bases 1..4049 =Contig6260_Contig6412 1031..5079
PRODUCT
Function Produces ATP from ADP in the presence of a proton gradient across the membrane. The beta chain is the catalytic subunit.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex V: F0/F1 ATP synthase
EXTERNAL RESOURCES
GO GO:0005753
Cellular component: proton-transporting ATP synthase complex (sensu Eukarya).
GO:0005754
Cellular component: proton-transporting ATP synthase, catalytic core (sensu Eukarya).
SwissProt AC  --
HGSC (Dpseudoobscura) Contig6260_Contig6412
View Sequence REFERENCE SEQUENCE
Contig Contig6260_Contig6412
Sequence Location 1031..5079
Sequence Lenght 4049bp
Relative Gene location 1052 .. 3233
CDS
CDS Location 1052 .. 3233
Sequence Lenght 506aa
Translation MFALRAAAKADKNLLPFLGQLSRSHAAKAAVKAASVANGKIVAVIGAVVDVQFDDDLPPI
LNALEVDNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQKVLDTGYPIRIPVGAETLG
RIMNVIGEPIDERGPIPTDKTAPIHAEAPEFIEMSVEQEILVTGIKVVDLLAPYAKGGKI
GLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERTREGNDLYNEMIEGGVISLKDKT
SKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQDVLLFIDNIFRFTQAGSEVSALL
GRIPSAVGYQPTLATDMGSMQERITTTKKGSITSVQAIYVPADDLTDPAPATTFAHLDAT
TVLSRAIAELGIYPAVDPLDSTSRIMDPKKIGQEHYNVARGVQKILQDYKSLQDIIAILG
MDELSEEDKLTVARARKIQRFLSQPFQVAEVFTGHAGKLVPLEQTIKGFSQILAGEYDHL
PEVAFYMVGPIEEVVEKADRLAKEAA
mRNA
mRNA Location 1052 .. 3233
5'UTR Location  --
3'UTR Location  --
Exon 1052..1115,1706..2020,2091..3233
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGTTCGCGTTACGTGCTGCCGCTAAAGCCGATAAGAATTTGCTTCCATTTTTGGGGCAA
TTGT
CTCGCAGCCATGCCGCTAAGGCAGCTGTCAAGGCAGCCTCAGTTGCTAACGGAAAG
ATTGTTGCGGTAATTGGTGCTGTCGTTGATGTTCAGTTCGATGATGACTTGCCACCAATT
TTGAATGCTTTGGAAGTTGACAACCGCTCCCCACGTTTGGTGCTCGAAGTGGCTCAGCAC
TTGGGCGAAAACACTGTGCGCACTATTGCCATGGATGGTACTGAGGGGTTGGTTCGTGGA
CAGAAGGTTCTCGATACTGGCTATCCGATCCGTATACCAGTTGGTGCTGAAACTTTGGGT
CGCATTATGAACGTTATTG
GGCGAACCTATCGATGAACGTGGGCCGATTCCAACTGATAA
GACCGCCCCCATTCACGCAGAAGCTCCAGAGTTTATTGAAATGTCCGTTGAGCAAGAGAT
TCTCGTCACCGGCATTAAAGTGGTCGATCTTCTGGCACCCTATGCCAAGGGCGGTAAGAT
TGGTCTGTTTGGTGGCGCTGGAGTCGGCAAGACTGTGCTGATTATGGAGCTGATCAACAA
CGTAGCAAAAGCCCACGGCGGTTACTCTGTTTTCGCCGGAGTAGGCGAGCGCACCCGCGA
GGGAAATGACTTGTACAATGAAATGATTGAAGGTGGTGTCATTTCCCTCAAGGATAAGAC
ATCTAAGGTGGCTCTTGTCTATGGGCAAATGAACGAGCCCCCAGGCGCCCGAGCTCGTGT
GGCTCTTACTGGTCTCACTGTGGCCGAGTATTTCCGTGATCAGGAGGGACAGGATGTGTT
GCTTTTTATTGACAACATTTTCCGGTTTACTCAAGCTGGCTCTGAAGTGTCCGCCTTGTT
GGGTCGTATTCCATCGGCCGTCGGCTACCAGCCCACTTTGGCTACTGACATGGGTTCTAT
GCAGGAGCGTATTACCACCACTAAGAAGGGATCTATCACCTCTGTACAGGCTATTTATGT
ACCAGCTGATGATTTAACTGATCCCGCTCCAGCTACAACTTTCGCTCATTTGGACGCCAC
TACTGTACTGTCACGTGCTATTGCTGAATTAGGTATATATCCTGCAGTCGATCCGCTTGA
TTCCACTTCTCGTATTATGGACCCTAAAAAGATTGGACAAGAACACTACAACGTTGCTCG
TGGTGTGCAAAAGATCTTGCAAGATTATAAATCTCTTCAGGATATTATTGCCATCTTAGG
CATGGATGAACTTTCTGAGGAAGACAAACTAACAGTCGCGCGTGCACGCAAGATCCAACG
CTTCTTGTCGCAGCCATTCCAGGTCGCTGAAGTCTTTACCGGACATGCTGGTAAACTGGT
TCCATTGGAACAAACCATTAAGGGCTTCTCACAGATTCTGGCTGGCGAATATGATCATCT
GCCGGAAGTTGCTTTCTACATGGTTGGCCCAATTGAAGAAGTAGTTGAGAAGGCTGATCG
TCTGGCAAAGGAAGCTGCCTAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GCTATTATTATCAAGTGCAATTATTATTAAACTTTTGGTTGATATTTTTAATAATGAATT
TATTATTTAAAAATCAGGAGCGCACGAGTCGGTGCCAGTGTGACCGTGAAATGTACAAGA
TGATTCTTAAAATTAATTTTAAAAAAAAAACTTTACAAACAAAATTCTTTGTTTTAGCCT
TTTATCATTTTTTTTCCAATTTTTAGCAAGTGTGATACCGTTTGCTTTCGTTGGGAAAAA
TCCCAAATTCCCAAAAGTCCTCAAGCCCAAAACAACACTACCACCCCACAAGCTAGGACA
ATCTATTAAATTTTATTTTCAACGGTATATAGAAATCCAATAAAAGCAAGTATTAAGAAT
ACACCAGTTAAATAGAAAATTGATCCATCAATCGTATAAAATTATGTGGGCATGGCTAAA
TGTTCTATCTGGCTTATTACGAAACATTAAAATTAAGCAATATAAGTTTCCAATCCTTGA
TGGAGAACGATTAACCTATTATAAGGGGGTATTTAAATTTTCCACCGAAAATAATGAAAA
TTTAATCATTTTAACGTAGTTCAGGTAGAGTTCGTGGGGTTTTTTGCAAGTTAAAGGGAA
AGATAGGGTGGATCTACAAGAAGAATTTACAATCGTCAATAGTTTTCGCCATTTGTCTCA
AGTAGCTGAACTATTTAAATAGAGGGGGCATAAGTGGGATAATTTCGGTTTTTCAGCATA
CGAGACGGTATATTGTAGTTGAAAAGCATAAACAGCAATTGCCGTAGCAAGAAAACAAAT
CAAGTATTTAAAACAAACCAGTCAAGTAGAAAATTGATTCCTTAATCGGATAAAATGATG
TGGGCAGTGCTAAATGTTCGTTTTAGATAGTAATATTCGACGGAATATCAAAAACGAGGA
ATATGTAAAATAGAACTGGAATTCGTCAGTATATTTACGGTATATTTTTAAAATGAGACG
GTATATTTTGGTATATTTCTGAGGGTCGGACGGTATATTTTACACTGCACCCCACAAGCT
AGCACACAATTTTCTAGTTCTCGCCCGAAAAATGTTCGCGTTACGTGCTGCCGCTAAAGC
CGATAAGAATTTGCTTCCATTTTTGGGGCAATTGT
GTAAGTACCTATTATAATCATGGAT
ATTATGTACTAAACTTGGATCGGGCCACAGTGGTGACGAAGAAAGCAACATAAAAGAATG
TGTAACATAACGTAACATTAATGCGAGATGGACATAACCTTAATTTGCGATTTTTCTCTT
ACGATTGAAAGGAAAAAAATGATTGCATAATAACTGAATGTTTGAAATGTTTCCTGAGAG
ACAATTGTCGTAGTTTGGATTAGAGCAATCATTTCATTATCATGTTAGATTGTCAATCTT
TTTGGTATTTCACATATACAGTTATATCCAGTTTTATAAATTTGTAGTGCAGTTAAAATA
CATACTTCAAATTAAATGAGAATTTTGCTTCATGGAATTTCTTAAATGAAAAAGGTTTGA
ATTATTGATATATTAAAAATTATTTAAATTTAATCGTTCTTGAAGAAAGTCGTGACGTAA
TCTTACACATCCATGTACATATGTATATATATATATGTATATATTCCTTGCGAATATTTC
ATCCAAACTATCGTTCATAATAAATAATAGTAAATAATTCATACATATCCTGAAGAGATT
TAATTTTTGAAACCATCTTTTTTAGCTCGCAGCCATGCCGCTAAGGCAGCTGTCAAGGCA
GCCTCAGTTGCTAACGGAAAGATTGTTGCGGTAATTGGTGCTGTCGTTGATGTTCAGTTC
GATGATGACTTGCCACCAATTTTGAATGCTTTGGAAGTTGACAACCGCTCCCCACGTTTG
GTGCTCGAAGTGGCTCAGCACTTGGGCGAAAACACTGTGCGCACTATTGCCATGGATGGT
ACTGAGGGGTTGGTTCGTGGACAGAAGGTTCTCGATACTGGCTATCCGATCCGTATACCA
GTTGGTGCTGAAACTTTGGGTCGCATTATGAACGTTATTG
GTATGTTTCAAATAAGTCAC
TCATAGTTTATAGATCGAACAATGTAATGTTGAATGTTTTTTTTATTTTAGGCGAACCTA
TCGATGAACGTGGGCCGATTCCAACTGATAAGACCGCCCCCATTCACGCAGAAGCTCCAG
AGTTTATTGAAATGTCCGTTGAGCAAGAGATTCTCGTCACCGGCATTAAAGTGGTCGATC
TTCTGGCACCCTATGCCAAGGGCGGTAAGATTGGTCTGTTTGGTGGCGCTGGAGTCGGCA
AGACTGTGCTGATTATGGAGCTGATCAACAACGTAGCAAAAGCCCACGGCGGTTACTCTG
TTTTCGCCGGAGTAGGCGAGCGCACCCGCGAGGGAAATGACTTGTACAATGAAATGATTG
AAGGTGGTGTCATTTCCCTCAAGGATAAGACATCTAAGGTGGCTCTTGTCTATGGGCAAA
TGAACGAGCCCCCAGGCGCCCGAGCTCGTGTGGCTCTTACTGGTCTCACTGTGGCCGAGT
ATTTCCGTGATCAGGAGGGACAGGATGTGTTGCTTTTTATTGACAACATTTTCCGGTTTA
CTCAAGCTGGCTCTGAAGTGTCCGCCTTGTTGGGTCGTATTCCATCGGCCGTCGGCTACC
AGCCCACTTTGGCTACTGACATGGGTTCTATGCAGGAGCGTATTACCACCACTAAGAAGG
GATCTATCACCTCTGTACAGGCTATTTATGTACCAGCTGATGATTTAACTGATCCCGCTC
CAGCTACAACTTTCGCTCATTTGGACGCCACTACTGTACTGTCACGTGCTATTGCTGAAT
TAGGTATATATCCTGCAGTCGATCCGCTTGATTCCACTTCTCGTATTATGGACCCTAAAA
AGATTGGACAAGAACACTACAACGTTGCTCGTGGTGTGCAAAAGATCTTGCAAGATTATA
AATCTCTTCAGGATATTATTGCCATCTTAGGCATGGATGAACTTTCTGAGGAAGACAAAC
TAACAGTCGCGCGTGCACGCAAGATCCAACGCTTCTTGTCGCAGCCATTCCAGGTCGCTG
AAGTCTTTACCGGACATGCTGGTAAACTGGTTCCATTGGAACAAACCATTAAGGGCTTCT
CACAGATTCTGGCTGGCGAATATGATCATCTGCCGGAAGTTGCTTTCTACATGGTTGGCC
CAATTGAAGAAGTAGTTGAGAAGGCTGATCGTCTGGCAAAGGAAGCTGCCTAA
GTAATTA
CACTGGAATACGAATAATAAAGTGAATTATGCATTGAAGTTTTAATAGACACTGTAACAT
CAACTTAAATTCTATAAACGAGAAGAACTCAATAAAACGTATTTAAATCATAGTCATTTC
CTTATACTGGTGCAAGTTCCTATAATTTTGATCAGGTGTTTTCAGCACACGCAAGGAAGC
ACCGACTATACTAAAAGGAGAAATGTAGATTTCAAGGGGTTCTAGCTATATTGTGGGTGC
GACACATTATGTTGAGACCCATCTGAATTTTCCATTGCGGTCTTGGTCTCGCCCTCTTGC
TCCCTCAAATCGGCAAAATGGTCATATCTATGTTACTAGATTGCAGAGATACTTTGCGAT
CGGAGAGAAGAAAACCATTTCCCTCGGCTGACTACTACCAAAGACTATACAATACCAAGA
TGTTGCATGAGGAACAAATTCTTTTTCAATTTTCGTTTGACGCTTCATGGTAAGGGCGCG
CGGGGCTATTACTTCAATTCTCTTTTACGCTACCTTCGCCTCCGAAATGCTACTCGGCTT
CGTCAATGCCTCGGTCAGCGTCGAGTCGGTGCGTCTCGAGAGAAAGAATACAAAAACAAA
ATATGAATCGTCTGCGTGCCGAAAGCGTAGGGCAGCGTGGTCGCTGATGTCTTTGGCGTG
GCACAGTGGGGACTCAGCAGAAATAGTAAAAAAATTGTATGAGTGCTTTAGATAAATTTA
ATGTACGCATCTAATAGAGAATTTTCCAATCGAATTTTCAAATAGTTTTAGTTTAGAAGA
TATAAGCACTCAAAGTTTAACATTTTTTC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004