login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG3612
Organism Drosophila melanogaster
Gene Name blw (CG3612)
Product ATP synthase alpha chain (ATPA) (By similarity)
GENE MAP
Chromosome 2R
Citogenetic Map 59B1--2
Gene Map
Comment This record is derived from the following: AE003458 gb|Y07894|DMASSUBA ATP synthase subunit alpha precursor  LP07742.5prime AI294383 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex V: F0/F1 ATP synthase
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0005753
Cellular component: proton-transporting ATP synthase complex (sensu Eukarya).
SwissProt AC  --
FLYBASE FBgn0011211
View Sequence REFERENCE SEQUENCE
Scaffold AE003458
Sequence Location  --
Sequence Lenght 5160bp
Relative Gene location 1032 .. 4134
CDS
CDS Location 1155 .. 3643
Sequence Lenght 552aa
Translation MSIFSARLASSVARNLPKAANQVACKAAYPAASLAARKLHVASTQRSAEISNILEERILG
VAPKADLEETGRVLSIGDGIARVYGLNNIQADEMVEFSSGLKGMALNLEPDNVGVVVFGN
DKLIKQGDIVKRTGAIVDVPVGDELLGRVVDALGNAIDGKGAINTKDRFRVGIKAPGIIP
RVSVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKRFNEAQDESKK
LYCIYVAIGQKRSTVAQIVKRLTDSGAMGYSVIVSATASDAAPLQYLAPYSGCAMGEYFR
DKGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSPAMGG
GSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAA
QTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDAATQQLLNRGVRLTELLKQGQYVPMAI
EDQVAVIYCGVRGHLDKMDPAKITKFEKEFLQHIKTSEQALLDTIAKDGAISEASDAKLK
DIVAKFMSTFQG
mRNA
mRNA Location 1032 .. 4134
5'UTR Location 1032..1154
3'UTR Location 3644..4134
Exon 1032..1220,1847..2427,2520..3321,3434..4134
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CAGCACTGCCTCACCGAACGTCTGGCCAGCGACCATCTTGTGAAAAGTACTACGAGTGTG
GAGAGGAGTTGGCTTAGGAATTGTACAATTACTTCTGCGGCGAACAGTTAAAAAGCATTA
AAA
ATGTCGATTTTTTCCGCCCGCCTGGCGTCCTCGGTCGCCCGTAACCTGCCCAAGGCT
GCCAACCAG
GTCGCCTGCAAAGCCGCTTATCCCGCCGCCAGTCTTGCTGCCCGCAAGCTC
CATGTGGCCAGCACGCAGCGTAGCGCTGAGATCTCCAACATCCTGGAGGAGCGCATCCTG
GGCGTCGCCCCCAAGGCTGATCTGGAGGAAACCGGCCGTGTGCTGAGCATCGGTGACGGT
ATCGCCCGTGTCTACGGTCTGAACAACATCCAGGCCGATGAGATGGTGGAGTTCTCCTCC
GGACTGAAGGGCATGGCCCTTAACTTGGAGCCCGACAACGTCGGTGTTGTGGTCTTCGGT
AACGATAAGCTGATCAAGCAGGGCGATATCGTCAAGCGTACCGGTGCCATCGTGGATGTG
CCCGTCGGTGATGAGCTGCTGGGTCGCGTCGTCGATGCCCTGGGAAATGCCATCGACGGC
AAGGGTGCCATCAACACCAAGGACCGTTTCCGTGTGGGAATCAAGGCCCCCGGCATCATC
CCCCGTGTGTCCGTGCGCGAGCCCATGCAGACCGGTATCAAGGCCGTCGACTCCCTGGTG
CCCATCGGTCGTGGTCAGCGTGAGCTGATCATTGGCGATCGTCAGACTGG
TAAGACCGCT
CTGGCCATCGACACCATCATCAACCAGAAGCGCTTCAACGAGGCCCAGGACGAGTCCAAG
AAGCTGTACTGCATCTACGTCGCCATTGGCCAGAAGCGTTCCACCGTCGCCCAGATCGTG
AAGCGTCTGACCGACTCCGGCGCCATGGGCTACTCCGTGATCGTGTCGGCCACCGCCTCC
GACGCTGCTCCTCTGCAGTACTTGGCCCCCTACTCCGGATGCGCCATGGGAGAGTACTTC
CGCGACAAGGGCAAGCACGCCCTGATCATCTACGATGATTTGTCCAAGCAGGCTGTGGCC
TACCGTCAGATGTCCCTGTTGCTGCGTCGTCCCCCAGGTCGTGAGGCCTACCCCGGTGAT
GTGTTCTACCTGCATTCGCGTCTGCTGGAGCGTGCCGCCAAGATGTCCCCCGCCATGGGA
GGCGGTTCCCTGACTGCTCTGCCCGTGATCGAGACCCAGGCTGGCGATGTGTCCGCCTAC
ATTCCAACCAACGTCATCTCGATTACCGACGGACAGATCTTCTTGGAGACCGAGTTGTTC
TACAAGGGTATCCGCCCTGCCATTAACGTCGGTCTGTCCGTGTCCCGTGTGGGTTCCGCT
GCCCAGACCAAGGCCATGAAGCAGGTGGCCGGTTCCATGAAGCTGGAGTTGGCCCAGTAC
CGTGAGGTCGCTGCCTTCGCCCAGTTCGGTTCCGATCTGGATGCCGCCACCCAGCAGCTG
CTGAACCGTGGTGTGCGCCTCACTGAGCTGCTCAAGCAGGGTCAGTACGTGCCCATGGCC
ATTGAGGATCAG
GTCGCCGTTATCTACTGCGGTGTGCGCGGTCATCTGGACAAGATGGAT
CCCGCCAAGATCACCAAGTTCGAGAAGGAGTTCTTGCAGCACATCAAGACCTCCGAGCAG
GCTCTGCTCGACACCATCGCCAAGGACGGTGCTATCTCGGAGGCGTCCGATGCCAAGCTG
AAGGACATTGTTGCCAAGTTCATGTCCACCTTCCAGGGTTAA
GCATCAGCAGCAAACGAA
GAATAGGAGTAGCGGTGCGTGCAATTAACATCATAGATGGCTCGAATAATGCTGCCATCC
CTGCGCGCCATCAACAACAACAAATAACAACCTACAACTTAAGATAAACAGAAATTATAA
AACAAAAACAAGAGAAAACTCCTTTGCACATTCATGTTTTCCTGCGCATCCTGACTGGAT
CGATCGCCTTCAATCCGTGGTTCGGTGCCATTATGCCGCAAAATCTTGGGAGAGAGAGAG
CCGGCCCTGGCTACGGAGTGGACGGCGAGCCCCAGCCGGATGCACTTTCGAGTTTCAGCG
AAAAATCCTTGCGGTTCCTCCAACCTCCAAAACGATAGATAATCCCCCGTTGTTCTTCTA
CCTAAAATATGTAATCAATATTTGAAATATTGTAATCGAGAATAGTCGAAATAATGTCTG
AGGATGATTGTGAAACGATGATGAATTAAAACGATACTAAATTATACTCTAAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GCCAGAAATTTCAAGACTTTTCTGGCCCCGCAGAAGGCAGCTTTCTGGACTCTTTCGGGG
GAGAGGTGGTGAAAATCCAGTGGGTTTATCCTCACACAAATATCCTCACATTAATGGCAC
ATGCAATTTTCCCCTACATTTGGCACCTAGCACCCAGCTTTCACCCGCAGTACCGTTATA
CCGTTCCGTTTTACCGTTTTACCGCCGCGTTGTGTTCACAGGACCGCACAAGCTCAGACT
GAAGCGACGAAGTGAAGCTGCGTGAGCGAGCGGCTGGTTGCTTTTACGCTTTAATACTAA
AAAAAAAGGAAAACGGTCCTTTTTGCTTTCGTTCGCTCGCGCGCACAGCTTCCTTTGCTT
CCTCTTTGTCGTCGGAGTGTAGACTTTCTCGCCGCTCTCTTTGCGCAACAATGAAACTCT
TGAAAGTCTCCAAAATGAACAGACCGTTTTAATATCTTGGCCATATTTCGAACGCATTCC
GATAAACATTTACTCCAAAGTCAAGTATGTGAATCTGTTAAGGTAAATAGGGATGTAATC
TGCCCATCCAATTACAATAGCATGCTTTTAGGCTGCTTATAAATTATCCCAGAGTTCTTC
GAACCATATTTATGGCGGCGTCCACATATAAATATAGTTAAGTTATCGCAACAGTCTTCA
ACGATCTTTGGTATTATCAGATGACCTGATTCCCTTGGTATTTTAAAATAAGTGTGAATG
AATCACATGAATGAATTCAAAATTTTCTAATAAGATTTCTACAAGTTTAAGAACATCACC
AACCATCGTATGTTTAATGTCACCACCAAGGGTGCCCGTATTACGACATAACGTGACCAC
ATATTTTAGGGAATTTTTAAAAAATAAGCATAGAAATTATCTCTTATAACTAAAGTCATG
TCCACTTTGCTTTGAGTATTAATTTAATTTGAGAAATTATATTGCGTCGCGTAAGCTGCC
ACCACTGAGGGTGACCGTACTTGCGACCGGTGTGCCCGCACCGCGCAATCACCAGCACTT
CGGCCGTTTCCCAGCACTGCCTCACCGAACGTCTGGCCAGCGACCATCTTGTGAAAAGTA
CTACGAGTGTGGAGAGGAGTTGGCTTAGGAATTGTACAATTACTTCTGCGGCGAACAGTT
AAAAAGCATTAAAA
ATGTCGATTTTTTCCGCCCGCCTGGCGTCCTCGGTCGCCCGTAACC
TGCCCAAGGCTGCCAACCAG
GTACCGCACCGAATTCCAGAAATTAAATCGCCCGACGAAG
AGTTGGCGAAAAAGTGTAATACATAACCGAATCGATGGGGTACTTTGCAGAAAATTAGTG
CATCCGGGTGGTTCAAAGATCGATCGAACTGTGGATAAAGACTTTCTGGATGCGTAGCAA
GTATTCGGGTGGGATTTTGTACCATTTTCCAACAAGAATTTAGTGTTACGCAATGCGGCG
AATTGCAAGGCGGCCGCTGAAATTGTGGGTTACATAATCAGTGCCAACCGAGAATTTGCT
AAGCAAAACAGAGTTTTTGGTTATTTTTTCAGTAAAAGTGTGCGAAGAACGCTGCAATGT
CTTTGTTTTTGTCCTCACATTACATAATTGTGATGTGGGTGAGATGCGGTGCCCGAAAAG
TTTGAGGTTAGGTGCGGCTGTCAAGCAAGTGGTGAAGGTGGAAAGAATACAAAGTGGGGA
AGTGCCGACATCCAGATACCCTGTAATCAGTTTTTTTTTTTATTAACTAGCTAGAAAGTA
CTGGAGAGAAGTTATTGAACGATCGTACCCTGCGGTTATCCAACGACACGGACCTACACC
TTACATAATCTCGCATAATCATATCGATTAACCTACTCTCTTACAGGTCGCCTGCAAAGC
CGCTTATCCCGCCGCCAGTCTTGCTGCCCGCAAGCTCCATGTGGCCAGCACGCAGCGTAG
CGCTGAGATCTCCAACATCCTGGAGGAGCGCATCCTGGGCGTCGCCCCCAAGGCTGATCT
GGAGGAAACCGGCCGTGTGCTGAGCATCGGTGACGGTATCGCCCGTGTCTACGGTCTGAA
CAACATCCAGGCCGATGAGATGGTGGAGTTCTCCTCCGGACTGAAGGGCATGGCCCTTAA
CTTGGAGCCCGACAACGTCGGTGTTGTGGTCTTCGGTAACGATAAGCTGATCAAGCAGGG
CGATATCGTCAAGCGTACCGGTGCCATCGTGGATGTGCCCGTCGGTGATGAGCTGCTGGG
TCGCGTCGTCGATGCCCTGGGAAATGCCATCGACGGCAAGGGTGCCATCAACACCAAGGA
CCGTTTCCGTGTGGGAATCAAGGCCCCCGGCATCATCCCCCGTGTGTCCGTGCGCGAGCC
CATGCAGACCGGTATCAAGGCCGTCGACTCCCTGGTGCCCATCGGTCGTGGTCAGCGTGA
GCTGATCATTGGCGATCGTCAGACTGG
GTAAGATTCTGGAGATAACCAAACCATGACACA
CCATTTCTCAATTGCTAGCAAGCAAAATTTAACCAAACAATTTTGTATTTAATCTGCAGT
AAGACCGCTCTGGCCATCGACACCATCATCAACCAGAAGCGCTTCAACGAGGCCCAGGAC
GAGTCCAAGAAGCTGTACTGCATCTACGTCGCCATTGGCCAGAAGCGTTCCACCGTCGCC
CAGATCGTGAAGCGTCTGACCGACTCCGGCGCCATGGGCTACTCCGTGATCGTGTCGGCC
ACCGCCTCCGACGCTGCTCCTCTGCAGTACTTGGCCCCCTACTCCGGATGCGCCATGGGA
GAGTACTTCCGCGACAAGGGCAAGCACGCCCTGATCATCTACGATGATTTGTCCAAGCAG
GCTGTGGCCTACCGTCAGATGTCCCTGTTGCTGCGTCGTCCCCCAGGTCGTGAGGCCTAC
CCCGGTGATGTGTTCTACCTGCATTCGCGTCTGCTGGAGCGTGCCGCCAAGATGTCCCCC
GCCATGGGAGGCGGTTCCCTGACTGCTCTGCCCGTGATCGAGACCCAGGCTGGCGATGTG
TCCGCCTACATTCCAACCAACGTCATCTCGATTACCGACGGACAGATCTTCTTGGAGACC
GAGTTGTTCTACAAGGGTATCCGCCCTGCCATTAACGTCGGTCTGTCCGTGTCCCGTGTG
GGTTCCGCTGCCCAGACCAAGGCCATGAAGCAGGTGGCCGGTTCCATGAAGCTGGAGTTG
GCCCAGTACCGTGAGGTCGCTGCCTTCGCCCAGTTCGGTTCCGATCTGGATGCCGCCACC
CAGCAGCTGCTGAACCGTGGTGTGCGCCTCACTGAGCTGCTCAAGCAGGGTCAGTACGTG
CCCATGGCCATTGAGGATCAG
GTGTGTATGCCAGGACTTACCTAGCAACTAACTTATATC
CGTAGTGACAACGCGGATATCGCGATTCCCGTGTAAAACCCAACCTCTAATCACCCAACA
TCAAATCTTCCAGGTCGCCGTTATCTACTGCGGTGTGCGCGGTCATCTGGACAAGATGGA
TCCCGCCAAGATCACCAAGTTCGAGAAGGAGTTCTTGCAGCACATCAAGACCTCCGAGCA
GGCTCTGCTCGACACCATCGCCAAGGACGGTGCTATCTCGGAGGCGTCCGATGCCAAGCT
GAAGGACATTGTTGCCAAGTTCATGTCCACCTTCCAGGGTTAA
GCATCAGCAGCAAACGA
AGAATAGGAGTAGCGGTGCGTGCAATTAACATCATAGATGGCTCGAATAATGCTGCCATC
CCTGCGCGCCATCAACAACAACAAATAACAACCTACAACTTAAGATAAACAGAAATTATA
AAACAAAAACAAGAGAAAACTCCTTTGCACATTCATGTTTTCCTGCGCATCCTGACTGGA
TCGATCGCCTTCAATCCGTGGTTCGGTGCCATTATGCCGCAAAATCTTGGGAGAGAGAGA
GCCGGCCCTGGCTACGGAGTGGACGGCGAGCCCCAGCCGGATGCACTTTCGAGTTTCAGC
GAAAAATCCTTGCGGTTCCTCCAACCTCCAAAACGATAGATAATCCCCCGTTGTTCTTCT
ACCTAAAATATGTAATCAATATTTGAAATATTGTAATCGAGAATAGTCGAAATAATGTCT
GAGGATGATTGTGAAACGATGATGAATTAAAACGATACTAAATTATACTCTAAA
TGAGTC
CTGCTCACACTTCTTTGCTGGGATTATTTCCTTTTGCTTTCTTTTTTAATTCCCGATTTT
GGTAATATAATTTAAAGAATTCTTGACAAATTGTTATGTTCTAAGCCATTTGGAGATGTC
TTGCCAGGAATCTTTGAGCATATTTTGTTAATAGGGGTTTTAAGCTTGGTTTCTTGAGGT
TCTGTTGCCGAAATGGATTTCCCTAACTAATCCTGGTCCTTTCGGCTCAGCTGATCCGCC
AGACGACGAGCAGATGTCCTTTTGCGTAACCGTAACCTCTTGACCCCCGTGCGAATTAGC
CACCCCTTGAACTACCTGAACGACCGCCTGTCTGCTCCAAGGCGCAGGATTCAGAAAGGA
ACTCGAACCCGGTGGTTCGGAGTGGTTCATGCTGTGCATATTTCGGTAACAGCAAGCCAG
AAGCGAGAGCAAGAAGTTTCCAAAAAGAGAAGAAGAAACAGAGGGTACCAAGACCCAAAA
ACTGTAAGCCCGATTTATACGGCATGGAGTTTTTATGACGCCGATTGCCACTGGCAGCCA
ACATAAAATATGCCAAAAGGGAGGAGCAGCGGAGGTGCCGAGAAAAATGACTTTCTTTTT
ACTACATTTGTTTGACCGTAAACAAGAATTAATGAGAGTCATAAAACCGTCAAACTTAAA
TTTCGAACAGGCGCACAGCAAAGTCAGCAGGCCGTGTACAGTGGGCGCTCTATAAGGCGA
ACAAATGTTGAAACTCAAACTTTTTACCTAATGCATTAATTGCTACTAACGAAAACTATT
TGAAATATTCGTTCGATAATTCGCTTATATGTTTCTTAAGAACTTAACTATAAGGTTGCC
TTTATTTGGCTTTGTATCGAGTAACTACTGTACATGAGAAAAGTGAGATAGACACCCACA
CACACACACGCACAACCATGTGCGAGCAATGTGCTCGGCAATTACCGTTGCCCATGGAAC
ACGGTACCAAAAAAAGGGAGAGAAAAGCGTTAAAAAGGGAAGAAGGAAAGGGAGAAGCGG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004