login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG3612
Organism Drosophila pseudoobscura
Gene Name Dpse\CG3612
Product ATP synthase alpha chain (ATPA) (By similarity)
GENE MAP
Chromosome pseudo3-mel2R
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig3295_Contig8282 The following contributed to sequence development: bases 1..4500 = Contig3295_Contig8282 570009..574508
PRODUCT
Function Produces ATP from ADP in the presence of a proton gradient across the membrane. The alpha chain is a regulatory subunit.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex V: F0/F1 ATP synthase
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0005753
Cellular component: proton-transporting ATP synthase complex (sensu Eukarya).
SwissProt AC  --
View Sequence REFERENCE SEQUENCE
Contig Contig3295_Contig8282
Sequence Location 570009..574508
Sequence Lenght 4500bp
Relative Gene location 1013 .. 3472
CDS
CDS Location 1013 .. 3472
Sequence Lenght 552aa
Translation MSMISARLASSVARTLPKSAAQIACKVAYPASTLAARKFHVASTQRSAEISSVLEERILG
ISPKADLEETGRVLSIGDGIARVYGLNNVQADEMVEFSSGLKGMSLNLEADNVGVVVFGN
DKLIKQGDIVKRTGAIVDVPVGYELLGRVVDALGNAIDGLGAIDTKDRFRVGIKAPGIIP
RVSVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTALAIDTIINQKRFNDAQEESKK
LYCIYVAIGQKRSTVAQMLKRLTDAGAMKYTIIVSATASDAAPLQYLAPYSGCAMGEFFR
DKGKHALIIYDDLSKHAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMSPAMGG
GSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSAA
QTKAMKQVAGSMKLELAQYREVAAFAQFGSDLDASTQQLLNRGVRLTELLKQGQYVPMAI
EDQVAVIYCGVRGYLDKMDPGKITNFEKEFLQLMKTSEQGLLDTIAKEGAISEATDAKLK
DIVSKFLATFQG
mRNA
mRNA Location 1013 .. 3472
5'UTR Location  --
3'UTR Location  --
Exon 1013..1078,1756..2336,2402..3203,3263..3472
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGTCGATGATTTCTGCACGCTTGGCGTCGTCGGTCGCGCGCACCTTGCCCAAGTCGGCC
GCACAG
ATTGCCTGCAAGGTTGCGTACCCAGCTTCCACTCTCGCTGCCCGTAAGTTCCAT
GTTGCCAGCACACAGCGCAGCGCGGAAATCTCTTCCGTCCTGGAGGAGAGAATCCTGGGC
ATTTCGCCCAAGGCCGATCTGGAGGAAACCGGTCGTGTGCTGAGCATTGGTGACGGTATC
GCTCGTGTCTATGGCCTGAACAACGTGCAGGCCGATGAGATGGTGGAGTTCTCCTCCGGT
TTGAAGGGCATGTCCCTCAACTTGGAGGCCGACAATGTCGGTGTGGTCGTCTTCGGTAAC
GACAAGCTGATCAAGCAGGGCGATATTGTCAAGCGTACTGGCGCCATTGTCGATGTCCCA
GTCGGTTATGAGCTGCTGGGTCGCGTTGTCGACGCTCTGGGTAACGCCATCGACGGCCTG
GGCGCCATCGACACCAAGGACCGCTTCCGTGTCGGCATCAAGGCCCCCGGCATCATTCCC
CGTGTGTCTGTGCGCGAGCCCATGCAGACCGGAATCAAGGCTGTGGACTCTCTGGTGCCC
ATCGGTCGTGGCCAGCGTGAGCTGATCATCGGCGACAGGCAGACTGG
AAAGACTGCTCTG
GCCATTGATACCATCATCAACCAGAAGCGTTTCAACGACGCCCAGGAGGAGTCCAAGAAG
CTGTACTGCATCTACGTTGCCATTGGCCAGAAGCGTTCCACTGTCGCCCAGATGCTGAAG
CGTCTGACTGACGCCGGCGCCATGAAGTACACCATTATTGTGTCTGCCACCGCTTCGGAT
GCCGCTCCCCTGCAGTATCTGGCTCCCTACTCCGGTTGCGCCATGGGCGAGTTCTTCCGC
GACAAGGGAAAGCACGCTCTGATCATCTACGACGATTTGTCCAAGCATGCCGTCGCCTAC
CGTCAGATGTCTCTGCTGCTGCGTCGTCCCCCAGGTCGTGAGGCCTACCCCGGTGATGTG
TTCTACCTTCACTCCCGTCTCTTGGAGCGTGCCGCCAAGATGTCCCCCGCCATGGGAGGT
GGATCCCTGACTGCCCTGCCCGTTATTGAGACCCAGGCCGGTGATGTGTCCGCCTACATT
CCAACCAACGTCATTTCGATCACTGACGGCCAGATCTTCTTGGAAACCGAGTTGTTCTAC
AAGGGTATCCGTCCCGCCATCAACGTCGGTCTCTCTGTCTCCCGTGTCGGCTCCGCTGCC
CAGACCAAGGCCATGAAGCAGGTTGCCGGCTCCATGAAGCTGGAGTTGGCTCAGTACCGT
GAGGTCGCTGCCTTCGCTCAGTTCGGTTCTGATTTGGATGCCTCCACCCAGCAGCTGCTG
AACCGTGGTGTGCGTCTGACTGAGCTGCTCAAGCAGGGACAGTACGTGCCCATGGCCATT
GAGGATCAG
GTTGCTGTCATCTACTGCGGCGTGCGTGGTTACTTGGACAAGATGGACCCC
GGCAAGATCACCAACTTCGAGAAGGAGTTCTTGCAGCTCATGAAGACCAGCGAGCAGGGT
CTGCTCGACACCATTGCCAAGGAGGGCGCTATCTCTGAGGCCACCGATGCCAAGCTGAAG
GATATTGTTTCCAAGTTCTTGGCCACCTTCCAGGGTTAG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
AATACAGGGGGCTTTAGTGGGCTAAGACGCTTGCACGGTTATTCTGTGCTTCCCACTATC
GCCCACTATCGAAACATTGAACCGTCGATATTTAGTAGCGCGATAGTGTCTTACCATCGA
TAGTGTCCCTCTACACCAAATTAGTGATGTAAATTTGTTGTCCATCGATGTTGTCAAAAT
CAAACATCGATGTTGGATTGATACATCGGATTTATTCTTCGATGCATCGATGTATGACCG
CGAAATCAGGATCTGATGATTGCGATGGGAATTAGTGACAGGCAATTGTGGTACTGTTTC
TGATACTTAGTTTTATTGAACAAATGGATCTCTAGCAGCAGTGGTACTCTTATTGTATGG
GAAGGAACGCACAGGCTCCATGTGAGTGTATTTTTAGATAGGGTACACTTACTCTGTGCG
GAGGTTACATTTCAGTGCATTTACTTAGGTACTTGGCAGCAATAGAGTAAATAGTTTATT
GCTTCACCCTTTTTGGTGGGTTCGAGTTTACAAGTGCAATTGTCTATTCTTAGTTGCTAA
TGTAATTTTCGTGTCGTCATATTCATTGACATGAAGTGACATGGACAATTGTATTTATGA
GTATTTGTGTATGAGATTGTACTGTCTATTCTGTAATATTAATAAGGTATATGTCTGTGA
CTGAACAGTACCCTTCCCAAACACACAACGGGTTGCCTTCGAATGATGTTAACGCCGTTC
GCAGTTTCATATTTAAACAAATGTATACCATCTATAGTAAATTTGATTCATTTTAAGTCA
AATATGAAATTAAACTACCGATGTTTTGCAAAACATCGATACATCACTCAACATCGGTAG
CAGCAAAAACATCGGAAAACATCAGTGAACATCGGCAGAAAAACATCGATGCTCGATGCT
CGATGCATCGATGTTTTTCTTACATCACTATTGAAAAAGTCTACGAGGAGAGGAGTTGGT
GTGGGAATTATTTAATTATTTTCTGCGGCAAAAGAGTTAAAAAGTATAGAAAATGTCGAT
GATTTCTGCACGCTTGGCGTCGTCGGTCGCGCGCACCTTGCCCAAGTCGGCCGCACAG
GT
ATTAAAAACTGAAAAACAGCCACGGCAAAAAATTTGCATATAGAAGTTATACATAATCCC
ACCCAATTGCCGAGAGAATTGGCGAAGAAAAAGTGCAGCCTAAGTAGAAATGGATTATAA
AGCATGGTTGGAGGAGACTCCCCAGTAGCGGCCAGCGGATCGCTTGGTTTTTCAGCGTTT
TGGCCAAGAATTTGTGTTACGCAATTCGGCAAAAATCGTAAACGGCCGGATGGTGGCTCC
TCTGTTACATAACTATCGCTAAGATGTCTAGGAACTTGAAATTGCAATTTGGTAGCTAAT
CGCATAGTAATTGTGACTAGAAACGCGCAAGGTGCATTTGTTGTGTAGAAATATTACATA
ATTTTGGGTATGTCGGCTTCGCCATCGGCTCGTTGGCAGTACCCAAAAGTGTGAGGTTAT
GTGCAAGGCAGCAAGTGTCGAGCCAGCAGTTGAGTGCATGAGGGGGTGTGCGGAGACTAG
AATTGGTAAAAAAAAAAGCCGTAGAGTTTCGTGAACCTATTATTCGTGGGTAAAAAACCA
CAAAGCAGATGAAAAGCTGGTGTCCCTCGTGTAGTGGTTACTCAACTACGGCACATTCCC
TCCGCACACACTGGCCTTACATAAGCGAAATTGTTAGTAATTCCGGAACTCGATTCGATT
GCTATTCTCTTCCAGATTGCCTGCAAGGTTGCGTACCCAGCTTCCACTCTCGCTGCCCGT
AAGTTCCATGTTGCCAGCACACAGCGCAGCGCGGAAATCTCTTCCGTCCTGGAGGAGAGA
ATCCTGGGCATTTCGCCCAAGGCCGATCTGGAGGAAACCGGTCGTGTGCTGAGCATTGGT
GACGGTATCGCTCGTGTCTATGGCCTGAACAACGTGCAGGCCGATGAGATGGTGGAGTTC
TCCTCCGGTTTGAAGGGCATGTCCCTCAACTTGGAGGCCGACAATGTCGGTGTGGTCGTC
TTCGGTAACGACAAGCTGATCAAGCAGGGCGATATTGTCAAGCGTACTGGCGCCATTGTC
GATGTCCCAGTCGGTTATGAGCTGCTGGGTCGCGTTGTCGACGCTCTGGGTAACGCCATC
GACGGCCTGGGCGCCATCGACACCAAGGACCGCTTCCGTGTCGGCATCAAGGCCCCCGGC
ATCATTCCCCGTGTGTCTGTGCGCGAGCCCATGCAGACCGGAATCAAGGCTGTGGACTCT
CTGGTGCCCATCGGTCGTGGCCAGCGTGAGCTGATCATCGGCGACAGGCAGACTGG
GTAA
GTGGTGAAGAGCTCTACCCACAGTTTCTCCAACTGACTCTGTAACCTGATCGCTTTTGCA
GAAAGACTGCTCTGGCCATTGATACCATCATCAACCAGAAGCGTTTCAACGACGCCCAGG
AGGAGTCCAAGAAGCTGTACTGCATCTACGTTGCCATTGGCCAGAAGCGTTCCACTGTCG
CCCAGATGCTGAAGCGTCTGACTGACGCCGGCGCCATGAAGTACACCATTATTGTGTCTG
CCACCGCTTCGGATGCCGCTCCCCTGCAGTATCTGGCTCCCTACTCCGGTTGCGCCATGG
GCGAGTTCTTCCGCGACAAGGGAAAGCACGCTCTGATCATCTACGACGATTTGTCCAAGC
ATGCCGTCGCCTACCGTCAGATGTCTCTGCTGCTGCGTCGTCCCCCAGGTCGTGAGGCCT
ACCCCGGTGATGTGTTCTACCTTCACTCCCGTCTCTTGGAGCGTGCCGCCAAGATGTCCC
CCGCCATGGGAGGTGGATCCCTGACTGCCCTGCCCGTTATTGAGACCCAGGCCGGTGATG
TGTCCGCCTACATTCCAACCAACGTCATTTCGATCACTGACGGCCAGATCTTCTTGGAAA
CCGAGTTGTTCTACAAGGGTATCCGTCCCGCCATCAACGTCGGTCTCTCTGTCTCCCGTG
TCGGCTCCGCTGCCCAGACCAAGGCCATGAAGCAGGTTGCCGGCTCCATGAAGCTGGAGT
TGGCTCAGTACCGTGAGGTCGCTGCCTTCGCTCAGTTCGGTTCTGATTTGGATGCCTCCA
CCCAGCAGCTGCTGAACCGTGGTGTGCGTCTGACTGAGCTGCTCAAGCAGGGACAGTACG
TGCCCATGGCCATTGAGGATCAG
GTGCGTAGCCTATTGATGCAACCTCTGCGATGTGGCT
CTAATCTCTTCTTCCACTCAAGGTTGCTGTCATCTACTGCGGCGTGCGTGGTTACTTGGA
CAAGATGGACCCCGGCAAGATCACCAACTTCGAGAAGGAGTTCTTGCAGCTCATGAAGAC
CAGCGAGCAGGGTCTGCTCGACACCATTGCCAAGGAGGGCGCTATCTCTGAGGCCACCGA
TGCCAAGCTGAAGGATATTGTTTCCAAGTTCTTGGCCACCTTCCAGGGTTAG
AAATTGTA
ACATCAGTCAACCGCGCGGTTTAACATCTTAGATGCGGCGGAGAGATTACCCTAAAAGCA
AGATCAATAAAGTAGAATATTGTCTAAGTCGAAAGTCCCCTAACAATTTCATTACTGCCC
ATTGCCGCGCGCAGATCTAATAATCAAGAATAACATCATAAAGAAGCCTACACTACAACT
TAAGATAAATCAAAAATTATACAAAAAAAAAGAAAACCCTTTTGCGCATTCATGTTTTCC
TGCGTTTCCAGCCATCTCCGTGCCCCGACACGTCGCCCAACGCCACAAAATGCCACAAAT
CTTGGGAGAGAGGGAGAGCAGGGCGGAAGGCGGCGGACGGGGCACGGAATGGACGGATCC
AGTTTCGAATTTCAGCGACATCCGTGTGGTTCTTCCAACCATAAGATAATGATAATGATA
ATTGTTCTTCTACCCTAAAAAATTGTGTAATCAATATTTTAAATATTGTAATCGAGAATA
GTCGAATACTGTCTGTGGATGATTGTGAAACGATGATGAAATAAAAACGATACTAAATTA
TACTTTAAACGAAGAACTATCGAAGGAGCTATATTTATTTCATTCTTTGAAGATTTACAC
CTTTTAATTGGTATTGTTCGTAGCCAAGAGATTCTGAGAAAGCGCAATGTAGTCTTTATT
TGAATTTTGCCACAGACAAGAAGATCCCAAAGAGATTCTCTTAATAATAAGAATAAGTAG
AGGGCGGTAATAATATATTCCTATGCTATTTGCGTATGAGTATCAAAGAATACAGGACCT
GCAAATGAAGGCTATTTATTTATATGTATTCTTATGAGAGTTTTATACAAGTTTGGTGGA
AGATATTAAATAGTGTTTCAATTAACTTACCTTCCAAAAGTCCTTGGTATTAGTCCTTTT
GTTCAGCTTGATCAAAAGTCTAGAATTCGGAATATTCTTATTATCTAAATGTTCCACGAA
ATCTTTTGTCAAGCCAATAATATGAGACGATATAATAACATAAAGATTATAAGTACTATG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004