login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG2249
Organism Drosophila melanogaster
Gene Name CG2249
Product Cytochrome c oxidase polypeptide VIIc (COXO) (By similarity)
GENE MAP
Chromosome 2R
Citogenetic Map 46D8--9
Gene Map
Comment This record is derived from the following: AE003831 RH32319.5prime BI575929 RH01480.3prime BI569403 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex IV: Cytochrome c oxidase
EXTERNAL RESOURCES
GO GO:0006091
Biological process: energy pathways.
SwissProt AC  --
FLYBASE FBgn0040773
View Sequence REFERENCE SEQUENCE
Scaffold AE003831
Sequence Location  --
Sequence Lenght 2880bp
Relative Gene location 997 .. 1576
CDS
CDS Location 1074 .. 1382
Sequence Lenght 66aa
Translation MLGRSSVIARNFSQSMVRFSGHGGVPGENLPFGLTNKYRITALFTIGCVLGFGSPFLIVR
HQLLKK
mRNA
mRNA Location 997 .. 1576
5'UTR Location 997..1073
3'UTR Location 1383..1417,1473..1576
Exon 997..1157,1266..1417,1473..1576
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATTTGTCATCTCTATTCTGCGCACCCACTGCGAACTTTATTTTCCTGGAATTATTATCAA
ATAAGTCAAATTGCGAG
ATGTTGGGCCGCAGCAGTGTGATTGCACGCAACTTTTCCCAGT
CGATGGTTCGCTTTAGCGGACATGGTGGAGTTCCCGGAGAG
AATCTTCCCTTCGGGCTGA
CGAACAAGTACCGCATCACCGCCCTGTTCACCATCGGCTGTGTCTTGGGCTTCGGATCGC
CCTTCCTGATCGTCAGGCACCAACTGCTCAAGAAGTAA
GGGGCTCCCCTGGCGACAGCAA
CAACAAATGTAAG
ATGTAGCGTTATCTGCTGAGTTGGCCGGCAGGCCATTACAGTGTGTT
ACAGCTTAAATTTAAGTAAAAAGTGGAAACGAAATAAAGTTACCCGTGACCGTAGAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TACCCAATATGGGCGGTGGGGTGGACGCGGGGTGTTTACTTATAATTTTGTGCAATAATT
TTGAACGTTTGTCTGTTTGGATCGAGTCTACCGTACCCGTGCGTATAAATGAAATATTCG
AAACGCAATAGAGATGAGCGCTCGGCGTGTTTGATGGGGCCAGCGATGGCCCTAGTTGCC
GATAGTTTTTGACAAGATAACAGAGCGCTTAGTGTCTGTTAAGCCCCTGAATAGATAAAA
TCGAATACCCCTAATACCGTGTCAAACTCGCTCGTTATTATAAATTAACAACAATTCGCG
TGGGCGTAGTTGGAAGCAAATTAACGTAAAATTCTTTTTATTATTATTAATTTTAAATGA
TTTCAAATAAATATATAAATAGATAACATTCAAATTTTATTTACGTTAAAATAAAAACAC
GGCACTGTTATATATATTTATTTTATATAAAGGGAAAATATTTCTAAAATTTAAGAGGAA
AATGAAACAAATTTTTACTAATTATATTTAGCATGCTGTGTACGGGACATTACGGATGGC
AGTCATTTAGAAAAAGGACACATCACTCGAGAGAAACGAATAAAATTTAATAGTTTTTAA
AAGCAGTTAAGAATTTAAAAATTTACATTTAAATGGATTGGGATTTGGTTTGAGGTTTGA
AAATAGTTATGTAGTGCACCGGGTGCCCAAGTGGTGTATTTGAAGTACCTACGTTGCACC
TAATAAATGAACTAGTAAGTACCAGCAATGAAGGAATGACTACGTTTTTCACCAGTACTT
ATAAAAATATTAAATAAATAAAAACGAAATACTTACGAAGTATTTAAGCCGTATAAATGT
TAGTCAAGCGATACCTAGGAAATTCTTATATTACATTTTACAAATTTATTTTTTTTAAAT
AAAATGTATTTTTTGTGAAGCCAAAGGCAAAGTTAACAGAAACCGCATTAACGTTAACGT
AACGTAATCAGCAGAGCTGCACGGCAGCTATCGACCATTTGTCATCTCTATTCTGCGCAC
CCACTGCGAACTTTATTTTCCTGGAATTATTATCAAATAAGTCAAATTGCGAG
ATGTTGG
GCCGCAGCAGTGTGATTGCACGCAACTTTTCCCAGTCGATGGTTCGCTTTAGCGGACATG
GTGGAGTTCCCGGAGAG
GTGAGTCCCTAAAAATGGGCCCATTGCGGGTTACATAATTTGC
ACGACTCGCATAGGATTGGGAGGAAAATCAATTCTAACACCGGAAAACACCTCATTCTCA
TGCAGAATCTTCCCTTCGGGCTGACGAACAAGTACCGCATCACCGCCCTGTTCACCATCG
GCTGTGTCTTGGGCTTCGGATCGCCCTTCCTGATCGTCAGGCACCAACTGCTCAAGAAGT
AA
GGGGCTCCCCTGGCGACAGCAACAACAAATGTAAGGTTAGTTTATTGGTTATATTCGG
TTTGCATTTTAATATAAATATTCACTTTTCAGATGTAGCGTTATCTGCTGAGTTGGCCGG
CAGGCCATTACAGTGTGTTACAGCTTAAATTTAAGTAAAAAGTGGAAACGAAATAAAGTT
ACCCGTGACCGTAGAA
CCGATTGGTGGATGTTTTCTTTAAAAGCTGGCAAGACGGCTTAT
GTGGAACAACAGTTTGTTTGGTATTGGCACTTGTAAATGCATCCACGCTTATTTTTAAAG
CTTTTAGTATCAATATCTTGTGGCTAAACTATGGAAACTGTGCTCGCAAATAACATGGAC
TTGGTAGAACGACGTCAGAAACCGATGTACACGCAAAGTTGCCAACTGGAAGGAATATTT
CTAGTAATGGTGAAGTTTTAAGGGTTCCCTTAAGTAGGCTTGCCTATAAAGATATATGTC
AGGAAATTTTTCGAAAAGCCAGTAACTTTCATTCGTTCGCTAGAAATCTGGGAGTAACTT
CTCACTCGCAAGCAATCAAATAATTTCTTATTCCCGTCTCAACAAACGGATTAAAATTTA
CTCATGTGGCCCACACTTCGTAAACCCATTGGCAAGTTTAGCGGGCCGCTGATGCGTTAT
GGGAGTGGATATCCAGGCGGCTCTCCTGGGGCGGTAGTTAATCCAAGGTCAACACGCAGC
TAACCATTCTAAGAACTTACAATTTCCCTCACAGAACTTACCCTTTGGCTTGGATAGTCC
AATGCGTTTCACACTATTTTACCTAATTGCGGGAGTCGTGGGCTTTGGGGCTCCGTTCCT
AGTTATTCGCCATCAGATGCTTCGTAATGTAACCAATGATCCGTAAGTAATCCGAGTAAT
CCAATAAAATCGTATCGTTATTAATGTTTGCTTTACAGCAAGGATGAGTAATCCCAAAAT
GACATAGAACACTCGTTAATAAATTAATAAAAATACATTGCACATGGAATTTATTGTCGT
ACATAATTTGTAACACTTGGCATGGTTTTCTTTACATTAGCTAAACATAATTTTCGTTCG
AAATATCAGTACAAAGACCTCCACTGGCGGCGATCAAGGAAATTCGTTAATTAACTAAGC
TTTCACTGGGACAAACTACAGTTCCTCTTTGCCATCAAAGTCATACTCCTCCTGGACCGG
CGATTCGTCGCAGTAGCTCGCTTGTTCTGAGCAGATCTTGATGTCTAAATCGTTTCCGAG
CTCTTCGGCCTGGAAGGCTTTAACGAAGATCTCATCGTTGTCCTCCAGTACTTCGTTGCA
GAAGTGCCCCAGGCTTTTGTTGAGATCACCATCTTGCACAAAGTCAACCAACGAGGAGTC
TGGGTTCATCTGACCATTGATGATCATCTTGAGGAGTGTGAATTTCCCGTTGCTCTTGTA
GGTTGCCTTCAAGTAGTCGTCCATTTTTTCGCCTTAGAACGGGAAAATATTAGGAATGAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004