login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG16939
Organism Anopheles gambiae str. PEST
Gene Name agEG16939
Product NADH-ubiquinone oxidoreductase 20 kDa subunit (NUKM) (By similarity)
GENE MAP
Chromosome X
Celera Gene agCG49073
Citogenetic Map 4A-4B
Gene Map
Comment This record is derived from the following: gb|AAAB01008846.1 gb|BM650663.1, mRNA sequence gb|BM629788.1, mRNA sequence The following contributed to reference sequence development: bases 1..3006 - AAAB01008846.1 8401720..8404725
PRODUCT
Function Unknown
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0016655
Molecular function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000016939
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008846.1
Sequence Location 8401720..8404725
Sequence Lenght 3006bp
Relative Gene location 1063 .. 2104
CDS
CDS Location 1386 .. 2009
Sequence Lenght 207aa
Translation MLAVRPLLTKALLLPSTNGAAEVLRSKATLPVVEKDKPEKLPYSPFGTKQSNWADWTVAR
LDDVLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRFGVVFRASPRQADVIIVAGTL
TNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRIIPVDIYVPGCPPT
AEALLYGVLQLQKKVKRMKTLQMWYRK
mRNA
mRNA Location 1063 .. 2104
5'UTR Location 1063..1126,1286..1385
3'UTR Location 2010..2104
Exon 1063..1126,1286..2104
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
CGAACCCCGAGCGGGTTTGCGTGTGGTGCGATATCTTAGTTCCAGAGGTTTTTCGGTGCT
TCAA
CGCACGGGACGTAGGCAGGAGTAAACGAAAGGACTTCGACCAACCACCTCAGCTTT
TTTTTTCATCTTCACCGGACCAACAACACCCAACAAGCTCAACG
ATGCTGGCCGTTCGTC
CGCTGCTGACGAAGGCGCTGTTGCTCCCATCAACCAACGGTGCCGCCGAGGTGCTCCGAT
CAAAGGCGACCCTGCCGGTGGTGGAGAAGGACAAGCCGGAGAAGCTGCCGTACTCGCCGT
TCGGCACGAAGCAATCGAACTGGGCGGACTGGACGGTCGCCCGGCTGGACGACGTGCTGA
ACTGGGGCCGCAAGGGCTCGATCTGGCCGCTCACGTTTGGGCTGGCCTGCTGCGCGGTCG
AGATGATGCACATCGCCGCCCCGCGCTACGACATGGATCGGTTCGGCGTCGTGTTCCGGG
CGTCACCGCGCCAGGCGGACGTCATCATCGTGGCCGGCACGCTGACGAACAAGATGGCAC
CGGCCCTGCGCAAGGTGTACGACCAGATGCCGGAACCGCGCTGGGTCATCTCGATGGGTA
GCTGCGCGAACGGGGGCGGCTACTACCACTACTCCTACTCGGTGGTGCGCGGCTGCGACC
GGATCATCCCGGTCGACATCTACGTGCCCGGCTGCCCGCCCACCGCCGAGGCGCTGCTGT
ACGGCGTGCTGCAGTTGCAGAAGAAGGTCAAGCGCATGAAGACGCTGCAGATGTGGTACC
GCAAATAG
ATAGTGTGCCTCTTTCCCGTTTCGTCCTGTTCTTCTCTGTTTGCTATTTTTC
CGGCGGTTTCTCGAGAGAAATAAAATTGTAGATCCGTAATATT
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
CGATCAACTATAGTTCTGCGTATGCGTACATATGTATGTATGCGGTACATGCGAGTGGTT
CCAAGAAACAAAATGAACATGTTTTCTCGCTCTGTTTGACCCGTCAGATAATCAAATCAG
ATAGAGGGAGGAAGCGTGCTCATTTTGTTGCTAGAGCCAACGCGCCAAGTATATTCGAAG
AATGTCTTGATTATTGCCGACAAAAATGTCATAACCAAGTGAGTGACCAAAAGCTGGGTG
CTAAACTGAATGTCAACAAGCATGTGGTTGATTCTCCAACTGTTTGAGTATCGTCACTGA
TCATCTCAGTTGTGTACGTGATCTGATTTGAGCTTCGTTTCAGTCAGAAGTGTTGATGAC
TGAAACAGTGGCATTTGGCAGCACTGTTCACAGTCAGCAAAAAATCATGATGATGCTTGC
GCCGGCATTAAGCTAAGCTTGTCCGTCAGAGTATCGCGTTGGACTCAAGAATTCGCGTTC
GGCATGTCATGCAGCACTTTTATTGAGAATCAGCAATGAGCATCAAGCTACCACGGATAT
GTTCGTTGTTTTCGTTGGTGAAAATCTCGTGATGCTCATGACATTTTGCAGCACTGGTCG
TGTCTGAACATCACGGATGAACGGACAACCGGATAAAAGATACGCTAAGATAAACAGCGT
TCCACTGTAGTAGCAAATTTTCCCGTTTAATTACGTTCAATTAAGATAAACAAAATATTC
CAATTTCATCGAGAATTTCCATACGTCCCAAGGTTCATATATACATAAGGTGAAGTTATT
CAAAACAAATTGATAATTAGGGACTTGGCATATACTTGGAGCTCTGGAATAAAAATAGGA
GAGAACTTATAGGGGGTATAGAACATTTTATGAGTTGCGTCATAGCAATTCCCAATCATG
GAGATCATTCAAACGCAACAATACTGCACCATCTTAATACATGCACCTTGTACCATATTA
GCAAACCCACCTGATTCTATATACCTTGCACGTCCACTGTCAAACGTTGACGTTTTGCGT
GTGTATTTTTCTGCATTATTCTTTCGCCAGCTTATGTAAAAACGAACCCCGAGCGGGTTT
GCGTGTGGTGCGATATCTTAGTTCCAGAGGTTTTTCGGTGCTTCAA
GTACGCAAAAGATC
GTTCCGATTCCGAATTCGCAAGCCCCCTTTCTGGCCCGGTCGGCTGGTGGTGCGGGAATG
CAAAGTGATTAACGCGCATTTATCCCCATTTTTTTCGTTTCTCCCTTTCGGCACAACACC
TCCTTCCGGACTTCCATCAAAGCAGCGCACGGGACGTAGGCAGGAGTAAACGAAAGGACT
TCGACCAACCACCTCAGCTTTTTTTTTCATCTTCACCGGACCAACAACACCCAACAAGCT
CAACG
ATGCTGGCCGTTCGTCCGCTGCTGACGAAGGCGCTGTTGCTCCCATCAACCAACG
GTGCCGCCGAGGTGCTCCGATCAAAGGCGACCCTGCCGGTGGTGGAGAAGGACAAGCCGG
AGAAGCTGCCGTACTCGCCGTTCGGCACGAAGCAATCGAACTGGGCGGACTGGACGGTCG
CCCGGCTGGACGACGTGCTGAACTGGGGCCGCAAGGGCTCGATCTGGCCGCTCACGTTTG
GGCTGGCCTGCTGCGCGGTCGAGATGATGCACATCGCCGCCCCGCGCTACGACATGGATC
GGTTCGGCGTCGTGTTCCGGGCGTCACCGCGCCAGGCGGACGTCATCATCGTGGCCGGCA
CGCTGACGAACAAGATGGCACCGGCCCTGCGCAAGGTGTACGACCAGATGCCGGAACCGC
GCTGGGTCATCTCGATGGGTAGCTGCGCGAACGGGGGCGGCTACTACCACTACTCCTACT
CGGTGGTGCGCGGCTGCGACCGGATCATCCCGGTCGACATCTACGTGCCCGGCTGCCCGC
CCACCGCCGAGGCGCTGCTGTACGGCGTGCTGCAGTTGCAGAAGAAGGTCAAGCGCATGA
AGACGCTGCAGATGTGGTACCGCAAATAG
ATAGTGTGCCTCTTTCCCGTTTCGTCCTGTT
CTTCTCTGTTTGCTATTTTTCCGGCGGTTTCTCGAGAGAAATAAAATTGTAGATCCGTAA
TATT
AAAAAAAAAAACGAAAAATGATATTGATTTGTCCACCGGCAATGTATTGCGCTGCA
GCCTTTTTCAGGTGGATCAGCGGAGCCAAATAGATTTTAAATATAATCGGGTGAGTGAGT
GAGTGAGTGGGGGATCATGAAATCAAACACAGCTGATACATAATACTAGAAGCGCTCTGG
GTTTGGATTATTTCCCTTTTGCGCACTAACTCTGAGTGTTGATCATGAGGATGGCCTCGA
TATGGATCTTTTACCAGGATAATAGAATATGCAAAAAGATAACGGAAAGTAATTTCATCA
AATAAGTCAATTATTAAAAAAAAAATCGTATGGTCAGTTTTGATTGAGCATTTTCTACCA
TCCACCAATTATTCTTTCTCATCCAATTAGTATGAGAAAGTTCACAAATCAACGGACTGT
TGACTTTCGTTCGTTTGCGGCTGTACAAGGTACGAGAAATCCATCGCAGCACACATTGGC
AAAACAAACTCGGGCGAGCGTGTGTGTGAAACGTCAAACGGCGCCAGCAGGTGACTAGTG
ATGGGTAAATTTAAAACAAATCCGTGACTCCGCCAAAATCGGAAGCGATTCCGAATGGTT
GGTGCACCACTTCAAACTCGGAATCTTCCGGAACCAGCCGAAGACGTTAGTCGGCAGCTG
GAGCTGTCAGGAGCCGACCGGAACCGTTGTAATAGTCGGAACAATTCAAATACAAAATTA
GGAGTTGATGAGTTAAAAACACGCCTTCATCATTTACTGCACCAAAGATCTTTTTTTAAC
AAAACAGGTAGTCCCCGAGATACACGGCACCTTTTATACGCAGATTTGAAGATATGCGAT
TTTATAAATTTGACAGTTCTGTAAGCAAATTGTACTGATTTGTCATATCAATTGTCAAAT
GCCAAA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004