login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG18193
Organism Drosophila melanogaster
Gene Name CG18193
Product Cytochrome c oxidase polypeptide VIIa (COXK, COXJ) (By similarity)
GENE MAP
Chromosome 3R
Citogenetic Map 84F13
Gene Map
Comment This record is derived from the following: AE003678 ID|AI945937|GB|AI945937 cDNA clone bs18e08 5' ID|BE978856|GB|BE978856 cDNA clone bs83f10 5' Reference sequence based on BDGP genomic sequence.
PRODUCT
Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex IV: Cytochrome c oxidase
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0006091
Biological process: energy pathways.
GO:0004129
Molecular function: cytochrome-c oxidase activity
SwissProt AC  --
FLYBASE FBgn0037579
View Sequence REFERENCE SEQUENCE
Scaffold AE003678
Sequence Location  --
Sequence Lenght 2580bp
Relative Gene location 1093 .. 1725
CDS
CDS Location 1180 .. 1555
Sequence Lenght 106aa
Translation MQRNCFSLRPFLRGVGDVGAVCKPIREFRNSAALKYAAAAAAAPKTRPGKVPPKMVKLRK
QFQADNDLPIFLKGGSMDNILYRLTWVLCFLGIGGDVWLWLGYIIA
mRNA
mRNA Location 1093 .. 1725
5'UTR Location 1093..1179
3'UTR Location 1556..1725
Exon 1093..1206,1262..1725
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
AGTAATAGTGTCACTTAAACATTATTCGATAGTTAAAGGCAGACAAAATTTTGTTCCGAA
TACTCCAGAAAGTTTCAGGAAACGTAA
ATGCAAAGAAACTGTTTCTCTTTGCGCCCCTTC
CTTCGGGGAGTCGGTGATGTGGGTGCAGTTTGTAAGCCCATTCGTGAATTTCGCAACTCG
GCTGCTTTGAAATATGCTGCTGCTGCAGCTGCAGCTCCGAAGACACGTCCTGGAAAAGTT
CCTCCAAAAATGGTCAAATTGAGGAAGCAATTTCAGGCGGACAATGATTTGCCGATTTTT
CTAAAAGGCGGCAGTATGGATAACATATTATACAGACTCACCTGGGTGCTCTGCTTCCTC
GGCATAGGTGGCGATGTATGGTTGTGGCTTGGCTATATCATTGCCTAA
AATCAACAGAGA
TCATGCAAGCAAGCCCACAAAACACAAATACTCTGTACACGAATGCAAATACCAATTGTA
ACGACACATACATTAGTTAACTAGTAACGTTTCTGTACATAGGTAGTTCAAATACGGAAA
ATCAATTATATAATAATAATAATGTGCTTTACTTCAAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
ACATCGATCTTCCTGAATCTCAACGCCATCATTCATTTCACTCTTTAAGTGCTGCCACAT
TCCCGTCAAAGGTTTGCGATAAAATCCATCACCTATGGCTATAAATACTTGAATTGGAAC
TCCCAGTTTAGCCACAATATGCTTGATCTTGACCTTAAAGTCATCTAGGTTGATTTTTCC
ACGAGCAATGCCTCCTTGGTTGGTGAAGAGACAGATTTTAAACCCATCCTTGTGGAGATT
CTTTAGTTTCTCCGGCACTTCGGGAAATATGATCTGCCAGTCGTCGGTGTTTTTGGGGAA
CACCAGTCCCGATTTTGTTTTTATAATGGTGCCGTCCATGTCGTAGCCAGCTATCTTTTC
AGAACCTTTAACGCCGACGCTGGTAAAGATAACCAGCTTACCATTGCCAGATGAGTCCCA
CCTCTCGGATTTCTCTGACGGTGATAGTGTTGTGGACAACGGCTCAGCTTTCTCCTTGTC
ATACTCCGGTGGAGGGTTAAAGACGACCTCGAACTGATGCCTGCCGTAAACGATCTCCAC
CAAGTCTCCGTGCTTCAGCTCGCGTTCCCCGTTCTGCATAAGCATCAGACCATTGACGCC
GCAGGGATTAACTCCCAGGACTTTAAGTGAAACTACAGCCTTTTTTAGGTCCACTTGCAG
TTGAATCTGTCGCTTCGAGCACTTGGAATCTCGGATGCCGGTCTCCCGGCTGCGTCCCAC
GAAATTCTCCCCAGCGGTCAGGTGTATAGAATGGTGTTCCGGCTCAGTGGGTTTAAGGGT
GCATATCCTGGCGGCCACATCCTTGCCAGCTTTTCCAACGGATCGGTTTAGGTATTTAGC
CATAGACATTTTGGTTAATCAATAAATAAGAGCATTGCTTAATATTGACACCAAAATTCA
CTAGAGAGCGAATAGTGTGACCTAATTTGGCATTAAAAGAAGAAGAGTGGCACACAGACA
TATGTACTTTGAAATGAAAGTGGTTGTTTTTACCTATTTAAATTGAAAAATAAATTACTC
CATATAAAAATCGGAGCCTAGGCTCTGTGTGAAACCCTTCCAGAAATCTTAAATCCATCA
AAGATGGCTTATAGTAATAGTGTCACTTAAACATTATTCGATAGTTAAAGGCAGACAAAA
TTTTGTTCCGAATACTCCAGAAAGTTTCAGGAAACGTAA
ATGCAAAGAAACTGTTTCTCT
TTGCGC
GTAAGTTACCACCATTCCATACAAAACATTAATTTAATTCGTTCTTTCCGATCA
GCCCTTCCTTCGGGGAGTCGGTGATGTGGGTGCAGTTTGTAAGCCCATTCGTGAATTTCG
CAACTCGGCTGCTTTGAAATATGCTGCTGCTGCAGCTGCAGCTCCGAAGACACGTCCTGG
AAAAGTTCCTCCAAAAATGGTCAAATTGAGGAAGCAATTTCAGGCGGACAATGATTTGCC
GATTTTTCTAAAAGGCGGCAGTATGGATAACATATTATACAGACTCACCTGGGTGCTCTG
CTTCCTCGGCATAGGTGGCGATGTATGGTTGTGGCTTGGCTATATCATTGCCTAA
AATCA
ACAGAGATCATGCAAGCAAGCCCACAAAACACAAATACTCTGTACACGAATGCAAATACC
AATTGTAACGACACATACATTAGTTAACTAGTAACGTTTCTGTACATAGGTAGTTCAAAT
ACGGAAAATCAATTATATAATAATAATAATGTGCTTTACTTCAAA
GTGTTCATTGGAGTT
TTTAAATTATGCCGCCAATATTTTGCCATTCACATATCATATAACACATATGTGGTGTTA
TATCGACTCACAAAGCAGCTGGTCACACTGCTTGAACAACTTGCACTTTTGTCGGCATTT
CTTAACTGCATATTTTCTCACTTTTTAAAGGTAAGTACGCACGAAATTACTTATTGATTA
TCTTTTCCACTTAAAACACGAATGCCCGGTGGGTTTTTGTTTGTTTTGCGATTGACTAAC
CACGTAGTTCTTAAACATTCACATTTTCCTTGGGCTCTGCCAGTTCTTCACGTTTTCGGG
CTCCATTTTAGCCATAGTTTTGTTTTCTATATTCTTGTGGTAAAACGCCGCTTAACTGCC
ACATCTGCAGTTTAGCCGGCTTGCTGGAGATAAAATTGCATTATCAAGTTTTCATGTGTT
CCCCGAGTTATTTGGCTTTTCATCCAAATTAAAGTAGCCTTTTCACATTTTCCAGTTGGG
CGACAAGTAATGTAAAGTCTTCAAATAGAATACTCTCAAAAAATTCCCAGTAATGTTTTG
GCTAAGAGGGCTACAGAGATCCCGGCAGCAACTGAACAGGCTGTGTCATTTCCGTAGTCG
TCTAAATTACGGGACCAGTCCCAGTATTCGCTCAGTCCAACCGTCAATCTCCAGAAGTTT
GGGATTTTGTAGCTCCCTCGTTCGTTACAGGTATTTGCCAGGTGTTATCTAAAGCCCATG
TATATAATCGGTCCGGTTCGCCATATGATATCTTTGCAGCTGCAGCACCAACCTTCCCCA
ACCCGCTGAGATGGCCAGTAAAACCGCGCACTTCGTCCTGCCTAACACGCAGCCCATTGC
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004