login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG9603
Organism Drosophila melanogaster
Gene Name CG9603
Product Cytochrome c oxidase polypeptide VIIa (COXK, COXJ) (By similarity)
GENE MAP
Chromosome 3R
Citogenetic Map 84F13
Gene Map
Comment This record is derived from the following: AE003678 LP02592.5prime AI259229 The following contributed to reference sequence development: bases 1..3000 = AE003678 87550..84551 Reference sequence based on BDGP genomic sequence.
PRODUCT
Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex IV: Cytochrome c oxidase
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0006091
Biological process: energy pathways.
GO:0004129
Molecular function: cytochrome-c oxidase activity
SwissProt AC  --
FLYBASE FBgn0040529
View Sequence REFERENCE SEQUENCE
Scaffold AE003678
Sequence Location  --
Sequence Lenght 3000bp
Relative Gene location 853 .. 1953
CDS
CDS Location 964 .. 1374
Sequence Lenght 89aa
Translation MMNLSRAVVRSFATTAGRRSAAVPKDQIEKGYFEIRKVQEHFQKKDGKPVFLKGSVVDNV
LYRVTVALALVGIGGMGKLFYELSVPKKE
mRNA
mRNA Location 853 .. 1953
5'UTR Location 853..963
3'UTR Location 1375..1466,1805..1953
Exon 853..981,1123..1466,1805..1953
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GATAATACATCGATATATCTCCAGTTGTCAGCTGTCATATTTCAGACCGATATTTTTCGC
CCAGGAAAACTGCTCACTTTTTGCTAAATCTTAAAAATAAACCCCAGCAAA
ATGATGAAC
CTGTCGAGA
GCTGTTGTCCGTAGCTTCGCTACCACCGCTGGCCGCCGGTCCGCCGCCGTG
CCCAAGGACCAGATCGAGAAGGGATACTTCGAGATCCGCAAGGTGCAGGAGCACTTTCAG
AAGAAGGACGGCAAGCCCGTCTTCCTCAAGGGATCCGTCGTGGACAACGTGCTCTACCGC
GTCACCGTCGCTCTCGCCCTCGTCGGCATCGGTGGCATGGGCAAGCTTTTCTACGAGCTG
AGTGTTCCCAAGAAGGAGTGA
AGTCGCAGTACCGAACCCTAAGCTAAGCCATTAAACCCC
GCGCAAGATCCGTGATTCAGCGTAGTCGCCTTATATTTCAATGTTTTGATTGT
AGCCTTG
CCCTGGATACCTGGACAACATGAAACACCCCAACCTACAACCTGGCTTATTGTTTTGTGT
TAGAATAGCTAAGATTTGATGTGTAAACTGAACATTCGCAAGAGCATTTAAAGCGTGGAA
ATATAAGAGATCTGGCTGTAAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
AAATGTACTTGGTCGAGAAATAAGGAAGTAAAATAAATTGTATTTAATCCAAAGTGAATA
TACGCTTAGCTATATCGGCGATCAACCAGTCCATGGAGCTAAGCAGTTTCTCGCCAGTCA
CTGCACTAACTCCGGCCACCAGCCAATGATGTGTGGTGATATCCTCTAGGTGTAGTATCT
TTAAATATAAAGTATATTAAATGTGTTGTTTCAATAAAAAATCAATGAGAGTGAACCTCT
TTAATTTCGTTGGATGAGAGGGCTCCCGGTAGATCCTGTTTGTTGCAGAGAACTAGGAGT
GTGGCTCCAGCTAATCGCTCTTCCTGGAGCAGAACTTGCAGCTCCTGGCCGCAGGACTCT
AGGCGCATCCTGTCAGCGCTATCCACCACCCAGACCAGACCATCAGTGGACTCGAAGTAG
TTTCTCCAGTAGGATCGCAGAGACTTCTGGCCACCGACATCCCACATATTCAGGGTGTAG
CCGTTGTGCTCCAAGGTTTTAATATTGAATCCCAGTGTGGGTGAGATGGTGTCTATGGGT
TCGCCATTAAAGCGCTTCAGGATTGTCGTCTTGCCGGCATTATCCAGACCTCTATAAGAA
AGTCGATACATGAATCACTATTTATTTTTTTATAATTCCATGGAACTCACAGCAGTAATA
TGCGCATTTCCCTTTCCTTCTGTCGCATCTTTTTTAATACTGTGAGGAAGCCCATGACAA
CGTCTGTATTTTAGTAACGCTATGGAATTATAAACAAATGTTTTTATTGGCAGCTGCTTA
AATTGTTTATTAAACTAAATAGGAATTTCCAGGTGAATGCCAAACTGCTGGAAATATCGA
CATCGATGTATCGATAATACATCGATATATCTCCAGTTGTCAGCTGTCATATTTCAGACC
GATATTTTTCGCCCAGGAAAACTGCTCACTTTTTGCTAAATCTTAAAAATAAACCCCAGC
AAA
ATGATGAACCTGTCGAGAGTAAGTAATTTACATTACTCTACACACCTTTCTGGAGGA
ACAGCATGAGTTCCGAAACACTGGAGATCCCATTACCTACATCCAATTACGTAAGTTCCC
TGGAGCCTCAGAACTAACCGCACATTTTGTACTCCTCGGCAGGCTGTTGTCCGTAGCTTC
GCTACCACCGCTGGCCGCCGGTCCGCCGCCGTGCCCAAGGACCAGATCGAGAAGGGATAC
TTCGAGATCCGCAAGGTGCAGGAGCACTTTCAGAAGAAGGACGGCAAGCCCGTCTTCCTC
AAGGGATCCGTCGTGGACAACGTGCTCTACCGCGTCACCGTCGCTCTCGCCCTCGTCGGC
ATCGGTGGCATGGGCAAGCTTTTCTACGAGCTGAGTGTTCCCAAGAAGGAGTGA
AGTCGC
AGTACCGAACCCTAAGCTAAGCCATTAAACCCCGCGCAAGATCCGTGATTCAGCGTAGTC
GCCTTATATTTCAATGTTTTGATTGT
GTAAGTTCCATTTTTTAGAATTTTGTGTTTATGC
TAGGTTGCTAAGTTCTTGACATAAAATATGACATTATCCAAGGACAACATTCCGTAAACT
ATTCCCTGTATTTGTCTAATAAATTTATAGACTATGTTTAAACCTTAAGTTATAATATTT
GTTTGCAAACTAGCATCTTAAAGTCTCCGTCTTATACAATAATAGTTTAATTAGGAATTT
TATTTGTACAATAATAGATATGTGTAACATGAGAACCACTTGCCTAAGAGATCTGCCATT
CAGATACAACATCTATCCCAAAAGTTTGTAACTAATCGCAATCCTTAATCCCTTTATCTT
GCAGAGCCTTGCCCTGGATACCTGGACAACATGAAACACCCCAACCTACAACCTGGCTTA
TTGTTTTGTGTTAGAATAGCTAAGATTTGATGTGTAAACTGAACATTCGCAAGAGCATTT
AAAGCGTGGAAATATAAGAGATCTGGCTGTAAA
GTAACGAGACTGCTTATTTGTTTTAGG
CACGGTCGCTGGCAACGAGATATTTGCCCAAAAGTATTTCCCCTTAATTGCATTGACATT
AAGTAAACAAACAGCGGCGACATGGAGCAGAGATCTGGGATGCGGTCGAGACTGGGGAAT
CGGCTAAGGAAACGGCCTGTTTTATAAATCAAAGGGCGGCAACTCGGCGCGTTGCCATTG
GCATGGAAATGCATTTTAAATCGAGCGAATCATGTTGCGCTTTAACACAAGCACAGGCCC
ATGCACGCCGCCCGTTTATTAATACCCGAGTGCGGCGGAATATGCAATTCATGACGTTTT
TCATTAGTTATTCTCCATAAACACTTAAATAAAACTAAAGCATTAAAAATTATGAAAACA
TCCGCCGCTTTATGCATTTTCCCTGGCATTTTCCACACACTCACAACGGGCAGTGCGTCA
CGAAACTGTTGTGGAATTTAAGAAATATGTTAGTTATTAAACGAGAAATAATATTTAACA
GATAGTTTCCGCAAACAGTTGCATGTTCTCAAGTCTAAGAGTATATTCCCTTATAGAAAA
CTCGTATAGTGAACTTAGTAAGTAACTTATCCTTATAGTTTCACCACGCACTGTACAGTG
CATACCCATCGAAGTGGAATAAACAGAAAAGCGTAATCTTTCCTCTTCTGTTGTGTTGCG
TTGCGTTGGTTTGCCATTATTCCGCTACGGCCCATTTGAATTTTTGGATGTGCGCGCGAA
ACGAAAAGTCATAAAGTGGACGCGGACTGGCCCACCGTAAACACATTGGGAATGGCCAGC
AGTTCTGCGTAGGTGGTTCCGAACGGAACTGAAAGTGGTGATCTGCTGCAGACATTGTAT
AGCCTATTCGTGGGCCATATGTGATCCCGAAAATATAGATTCCCCCGAAACGGAAAAGAG
CTCGATTTTTAATTAAAGTTCGTTTGGCTAATTATGGGATGGGAACGTAGCGGTGCACAT
GTCGCAAACTTATTATATTTCATAGACTGTGAAAAATTTAAATGAACACGAAATGCCAAA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004