login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG14028
Organism Drosophila pseudoobscura
Gene Name Dpse\CG14028
Product Cytochrome c oxidase polypeptide VIc (COXH) (By similarity)
GENE MAP
Chromosome pseudo4-mel2L
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig3635_Contig7816 The following contributed to sequence development: bases 1..2400 = Contig3635_Contig7816 228796..231194
PRODUCT
Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex IV: Cytochrome c oxidase
EXTERNAL RESOURCES
GO GO:0006091
Biological process: energy pathways.
SwissProt AC  --
HGSC (Dpseudoobscura) Contig3635_Contig7816
View Sequence REFERENCE SEQUENCE
Contig Contig3635_Contig7816
Sequence Location 228796..231194
Sequence Lenght 2400bp
Relative Gene location 1057 .. 1357
CDS
CDS Location 1057 .. 1357
Sequence Lenght 80aa
Translation MTNAPATSAASAAGPVLRGLHNATIKRNLAVSLGLTAIITVAYKVLINDPKKAAYAEFYQ
KYDAKKSFERMKAAGRFQSC
mRNA
mRNA Location 1057 .. 1357
5'UTR Location  --
3'UTR Location  --
Exon 1057..1235,1294..1357
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGACCAACGCTCCAGCAACCTCCGCCGCCAGCGCCGCCGGCCCAGTCCTGCGTGGCCTC
CACAACGCCACGATCAAGCGTAATCTGGCCGTGTCCCTTGGTCTGACCGCCATCATAACC
GTCGCCTACAAGGTGCTGATCAACGATCCCAAGAAGGCCGCCTACGCCGAGTTCTACCA
A
AAGTACGACGCCAAGAAATCCTTCGAGCGCATGAAGGCTGCCGGCCGTTTCCAGTCCTGC
TAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TTTCTTGTTTATTTTGTAAAAAAAACTTCGTAATTATAGAAATTCCACGAACAATAACAA
CCGCCATTTGCATTCGCCTTCTGTGGTAGCCATTTTTATTTTCCAGCCGGAGATGCCAAT
CGGCTTGTTTCGAAAATACCCTAAATTTTCCCTTTTTAGAGTTTTTTAGTCAATTTTCAT
GAATAACATATGATTGCTGACCAGCACTGTAAAATAATAAATAAATACACGAAATTTTAA
TTGTCATTTTATTTATTCAAACTAAATTAAACATTTCTATATAATTTTAAATAGGTTGTT
AATAGTATGGCGAGTTAGTTTTTATTTTTTGCGTTTTCCAGCACTAGGATGAAGTAGATG
ATTCATCCCTGGTAAGGACGAAAAATTTTACGCTTAAATTTTTGTTTTTCCTTTTTGGTT
TAAACCTTATTTTTAACACAATACAATAAAAAGGAGTACATCGAATCTGGCAATGGTGTA
GAAAATTGATTCATTAATTGGATTAAATTAGGTTTTCAGAGCTGAAGGTCTTATTTAGCT
AGTTATATGAAATCGAATACCAAAATCGAAGAATATGACTTCGATCATGAACGCATCCCG
ATTAACCCATTGTAGACCATTGTAAGGTATGCACACATGAATATCATGAAACTTAAAGAG
TTTTAGCTAAAAGATACCGTAGTTTTCTTTTGAAGTGAAACGAATCTACTACAAAATTGT
ATTTACAGTATTATTTTCCGCTGTTTAATTAAAGTTTTTCATCTGTTTATATTTAGGGGG
CCTAAGTGGGTTAAGTTCATTACGGTTCCGTATATATTTTATCGATATCTCCAGTCGAAA
TTTTTCTGCAAATGTGAGTGTTTTTCTTTTTAGATTTCAATAACTATTTAAAAAGGGTCT
AAAAAGACCTTTAATTTGATTTAAATTCTCATTTAATAGCAAGCTATTGGTGGGCATAAT
GCTGCTAGTGCTACAGCACTGCGCAAAATGGCACTGCGAAAATTACGTAACTGACGTCCA
ATACAAATACTTTTTCTCCTTACAGCCAGTCGAAAGATGACCAACGCTCCAGCAACCTCC
GCCGCCAGCGCCGCCGGCCCAGTCCTGCGTGGCCTCCACAACGCCACGATCAAGCGTAAT
CTGGCCGTGTCCCTTGGTCTGACCGCCATCATAACCGTCGCCTACAAGGTGCTGATCAAC
GATCCCAAGAAGGCCGCCTACGCCGAGTTCTACCA
GTGAGTACCAAGATAGTATATCTGC
TCTGTGACGTCCGACAATTCATTTCAATTGCAGAAAGTACGACGCCAAGAAATCCTTCGA
GCGCATGAAGGCTGCCGGCCGTTTCCAGTCCTGCTAA
GCGACCCTACGCCCCTAGGTGTA
CGCATATAGTATAAGTCGACGATGTGTTACGTTACGCTTCTGTATTGAAAACTAAATAGA
TTTCAATTCGTATGTGCACCGCGCTGTTTTACTGCCCAAAGACAAAGCTGATTCCGAGTC
GGGACTTAAGCGTTTTTATTATTTACTCGTATTTACAAACTTATCGAAATAGTGTACAGA
ACAAACAGAAAAATTGCACACCACACCATCATCATGGTGTGGACTGTAACACATCTAAAA
CCTAATGGCAAAATCCTTGTAATCCAGTCGGTTGAGGTTGCTCTGATTCCGCAGGTCGCA
GCGTTGGATCTCGCAGCCCGGCGAACCCTCGGTAGACAGCCAGGTGATCCTATAATGGAG
TTCAGCAATGGAATTACTTGAAAATCACTATCAAAGTGCATGTGCTACATACATCTTGTC
CACCTCATCCTTGGGGCCCTGCATTTTGCCGACAATCGTACCCTGCTTGCTGTTTTTCAC
CCATCCAGTGATGCCTGCCTTGGTGCAGCGGTCGCGTGTATCTTTCGTTAGGTTCAGACC
TGGCGATAATACAGATTCCCCAATTATTCTATATATTCTAGTGAAAGTGCCGTGGGGCGT
GAAACAAAGCCAAGGACAGCCGCAGAGGCAGGCAGTCCCCAAGTAACCAGCCAGCTACTT
TGGGTCTATTTTTAGCTGGTGGATATGGTACGAGTACCACCGCTTCCCACTGACCACTGC
CACTGCGCCTGCAGCCTTGAGCTTTGCCCTTGCTCCGATCCTGCCTGGCCACACCTTGTA
CATGTCCATACACCTCAAAGTCCAGTGTCACCAGCTGACGTATGTCCGGAATAATGCCCA
TTTCCACGGAAAACCGTTGAAACTTTACCAATTGCTGCGCACTTTTGGGTTATGTAAATC
TAAAACTCTTTTTTTGGATGGGTTCCGACTTTCCGTTTTCTTTAACTACACAAAATCAAT
TTCAAACTATTGGAAAGTTGCAGGCATTTAATATTTGATATCCAATCAAATTGTCAGAAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004