login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG9603
Organism Drosophila pseudoobscura
Gene Name Dpse\CG9603
Product Cytochrome c oxidase polypeptide VIIa (COXK, COXJ) (By similarity)
GENE MAP
Chromosome pseudoXR-mel3L
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig815_Contig5737 The following contributed to sequence development: bases 1..2340 = Contig815_Contig5737 4539572..4537233
PRODUCT
Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex IV: Cytochrome c oxidase
EXTERNAL RESOURCES
GO GO:0005739
Cellular component: mitochondrion.
GO:0006091
Biological process: energy pathways.
GO:0004129
Molecular function: cytochrome-c oxidase activity
SwissProt AC  --
View Sequence REFERENCE SEQUENCE
Contig Contig815_Contig5737
Sequence Location 4539572..4537233
Sequence Lenght 2340bp
Relative Gene location 898 .. 1313
CDS
CDS Location 898 .. 1313
Sequence Lenght 89aa
Translation MMNLSRAVVRSFATTTSRRSTAVGKEQIEKGYFEIRKVQEHFQKKDGKPVFLKGSAVDSV
LYRVTMALALVGIGGMTKLFYDLSVPKTE
mRNA
mRNA Location 898 .. 1313
5'UTR Location  --
3'UTR Location  --
Exon 898..915,1062..1313
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGATGAACCTGTCGAGAGCCGTTGTCCGCAGCTTTGCCACCACCACGAGCCGCCGCTCC
ACCGCTGTCGGCAAGGAACAGATCGAGAAGGGATACTTTGAGATCCGCAAGGTTCAGGAG
CACTTCCAGAAGAAGGATGGCAAGCCCGTCTTCCTCAAGGGCTCCGCTGTCGACAGTGTG
CTGTACCGCGTCACAATGGCACTGGCTCTGGTTGGCATTGGTGGCATGACCAAGCTCTTC
TACGACCTGAGCGTGCCCAAGACGGAATAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GCGAAGAGAGCGCTGACCGCCCACATCCCACATGTTCAGGGTGTAGCCATTGTGCTCCAG
TGTCTTGATGTTGAAGCCCAGAGTGGGCGAGATTTCGTCTATGGATTCGCCATTGAAGCG
CTTCAGAATGGTTGTCTTTCCGGCATTGTCCAAACCGCTGCAAAAAAGCATAACAATGAA
TCACAACTTGTTTGGCTCGCCGCAAAACTTGCTTAAAACTCACAGCAGCAAAATGCGCAT
CTCCTTCTCCTTCTGTCGCATCTTTTTTAATACTGTGAGGAAGCCCATGGCGACTCCTGT
GAGATATGACAGCCTACAAGCTATAAATTAACTATAAAATCAGCAGCTGCTTATGTTTTG
ATTGAGTGTGAATTAGAGGTGTCAAACCATCGATAGTAGCAACTAGCACCAAAACATCGA
TACTATCGATGGTTTGACAGCTCTAGTGAATACCCTCAAAATATACCCAGATATACCGTC
TTAAAAATATACCGAAAATATACTGACGAAGTTCTCAAGTTCTGTTATCCATATTCCTCG
TTTTTGATATTCCTTCAGATATTACTAGCTAGCCGAGAAACTCAGCGCTGCCCACATAAT
TTTACCCAATTAATGAACCTATTTTCTAAATGACTTGTTTATTTTAAATACTTGCTTTAC
CATTTCTGCTTAAATACAGCTTTTAAAATGAAATTTAATAAAATAAAAGTATACCTTTAT
ATACCGCAAATATACCGTCGGCTCAATTGTGACCTAAAAACTACCGAAAAGTATTAAAAA
TACAACGGGGTGGCAGCACCAATTCTCCAAAACAGCTGTCATAATTTGTCCGGATTTTCA
GCCCAGAAAAACTTTTCTCGCGTTTAGCTAAAAATATATAACAATATCTTCAGCAAAATG
ATGAACCTGTCGAGA
GTGAGTAAAATTTTGCGACTGGAAATAGCCCACAGGCACTGCTGG
ATGTGGAGCATTCCTCCAGGGCCTGGGAAAATATAGTTCACGGGCAATTACGTAAGGGCG
CTGGAGCTCCACCGAACTAACCGCACATTTTCCGTCTGCAGGCCGTTGTCCGCAGCTTTG
CCACCACCACGAGCCGCCGCTCCACCGCTGTCGGCAAGGAACAGATCGAGAAGGGATACT
TTGAGATCCGCAAGGTTCAGGAGCACTTCCAGAAGAAGGATGGCAAGCCCGTCTTCCTCA
AGGGCTCCGCTGTCGACAGTGTGCTGTACCGCGTCACAATGGCACTGGCTCTGGTTGGCA
TTGGTGGCATGACCAAGCTCTTCTACGACCTGAGCGTGCCCAAGACGGAATAA
TAGAGTG
CTTGCAGCGTATTCTACCTTTAAGCTAAGCCTCTAACCAACAGCAAATCCGCAATCCAGC
CCCGTACCACATTTGTTTTGCAGTGTAGTTGCCTTATATTTCCCCTCTTTTGATTGTGTG
AGTGCCTGTATTTGTCATAGCGAAATCAATAATTCAAAAAGTCTTCTTGCAGAGCTGAGA
GCTGGTCTACCTGGTCAAGATAAAACTCCTACGCCCCAGAACGTTGCTTTGTGTTAGAAT
TAACTAAGTTTTGATGTGTAACCGAACATTCGCAAGAGCATTTAAAGCGTGGAAATATAA
GAGCCTGGCCGTAAAGTAATCAAATTTCATGTATCTTAATGTGGCTGCTGCTGTCTGGGT
CCAGGAAAACCATGTTCCCATTCCCCCTTCTATAATATTGCAATAACATTAAGTAAACGA
ACAGCCGCCGCTCTTTTTCGATGGCAGATCTCAGAGGGGCTGCAGTGGGGACATGGGGAA
CGACCAGGGAGTCTGTTTTATAAATCAAAGGGCGGCAACTCGGCGCGTTGCCATTGGCAT
GGAAATGCATTTTAAATCGAGCGAATCATGTTGCGCTTTAACACAAACACAAACCCGAGC
CGAGCCCGCTGCATGTTTATTAATACTCGCCGCAAGGGAGAGGCAGAGGCGGCAGAGTGC
TGTGCTGCAAAATATGCAATTCAAGGCATTTTTTCATTAGTTATTTCTCCATAAACACTT
AAATAAAACTAAAGCGTTAAAAATTATGAAAACATCCGCCGCCTCTTTATGAATTTTCCT
TTGCATTTTCACACACACTCGTACATGTGTACAGTGCGTTCCCAGAATATTAAGAACATT
TTGTGTTGTACCGAAGACTACAAAATATGTTACTACCAAGATATTGGATATGATATCAGG
AACTAATTCCGCACCGCTGCCTTCTCGGCCTTGCCTGTTCAGTCAATGTCTTGGACAGTT
GAGTCGCAGAAAAGACTTACTTTTCGGACCGAAAATTCCAACCACAAATACACACTCTTT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004