login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG9172
Organism Drosophila pseudoobscura
Gene Name Dpse\CG9172
Product NADH-ubiquinone oxidoreductase 20 kDa subunit (NUKM) (By similarity)
GENE MAP
Chromosome  --
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig1154_Contig1157 (WGS as of 2003 08 28) The following contributed to reference sequence development: bases 1..2640 - Contig1154_Contig1157 1401..4050
PRODUCT
Function Unknown
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0016655
Molecular function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as
SwissProt AC  --
HGSC (Dpseudoobscura) Contig1154_Contig1157
View Sequence REFERENCE SEQUENCE
Contig Contig1154_Contig1157
Sequence Location 1401..4050
Sequence Lenght 2640bp
Relative Gene location 1026 .. 1688
CDS
CDS Location 1026 .. 1688
Sequence Lenght 220aa
Translation MLRSSILSTTIPKCLQIICQNSNAVSVVPALNGFWVRRQQTLPVVDSSKVLEKKGYSPFG
TKQASVAEWSLARLDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRAS
PRQADVIIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDRI
IPVDIYVPGCPPTAEALMYGVLQLQKKVKRMKTLQMWYRK
mRNA
mRNA Location 1026 .. 1688
5'UTR Location  --
3'UTR Location  --
Exon 1026..1688
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGTTACGATCATCTATTTTATCTACGACCATACCCAAGTGTCTGCAAATCATATGTCAA
AATTCGAACGCGGTATCTGTAGTGCCTGCACTAAATGGTTTTTGGGTTCGTCGACAACAA
ACTCTGCCGGTTGTAGACTCGTCCAAAGTTTTAGAAAAGAAAGGTTACTCACCGTTTGGC
ACAAAGCAAGCTTCTGTGGCCGAGTGGTCATTAGCAAGACTCGATGATCTGTTAAATTGG
GGTCGTAAGGGTTCAATATGGCCATTGACATTTGGTTTGGCATGCTGTGCTGTTGAAATG
ATGCACATCGCCGCACCACGTTATGATATGGATCGTTACGGAGTGGTATTCCGAGCATCA
CCGCGCCAAGCAGACGTAATTATTGTAGCTGGTACATTGACCAACAAAATGGCACCGGCT
TTGCGTAAAGTCTATGATCAAATGCCTGAGCCACGATGGGTTATTTCTATGGGAAGCTGT
GCCAACGGCGGTGGCTATTATCACTATTCGTACTCTGTAGTTCGCGGTTGCGACCGAATA
ATACCTGTCGACATATATGTCCCAGGCTGTCCACCTACCGCAGAAGCTTTAATGTACGGT
GTGCTACAGTTGCAGAAAAAAGTAAAACGCATGAAGACTCTCCAGATGTGGTACAGAAAA
TAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TGTTTCCCGCCCAATTTAATTCGGACTTCAAAATGTAACATATCGATAAAAAAAATATGT
GAAAAATGGAACACCTTAAAACGAAAACGAAACGTTTTGGCTGAAAACGTAATCCGCAAA
AGTAAATGAAAAACGGAGCCTGCCTGTATATCTAACTCTTGGGACTCTCCTTAAAGACGC
AGAAGCTCTGTTTGGAAGTTGCCTTGGCCTTGGCTGCTCGCAATATGCTGGAGTATTTCT
CGCTTTTGTTTCCTGCTGCTTCACCTGTTATTTCTTCTGCTTCTTCTGGACTTCCAGCAG
TTCCCGTTCACTCCCAGAAGGATGTCCAGTTTTGTTATGTTTTTGGGGCGCTTTGTCCGC
AGAAAGATTGCTGGGGCTTCAGTTGGATCTGTCCTAGTCGACATCAGATTTATTTCGCGG
TCACCGCAAGCCCGCAATTATATCGTGACAAATGGTTTTAAACCCTATTTTTTCTTCGAA
TTCCACTTCAACCTTCTGGTTTTTGTTTTTTTTTTTATGGCTGTAAAACACTGTTATACA
AAAAAATATCGCTTAGAAACGTAAGGATTAGTAACATCGCATATGTTCGACAGATATGTT
TCGCTCATTGAGCACATCAAGGTGGAATGGTGGGAATTTGTGGCAGATGTGAAACACAGT
TTCACATCCGTCAAAAATTAGCTGATGGCACAACATAAAAAAGTTTTGGTTTGAATTAAT
AAGTTAATTTGCTATTGGTGCTGCAGAGCTATCTGTAGAAGATTGTCCATAATAATTTCC
AGCTGGATCTGTTCTTCGTGGTANNNNNNNNNNTTCTCGTTCCATTTATATTGTTCCAGT
TCAACGCTTTTATGATTTAGGATACTATTATCGATATTTAATGAGCACTGACTAAAATGT
CGTAAATTTTCTTGCATCTCCCTTGCTGTTCTCGGAAACGTATTACATAAATAGGTATTT
CGATATATTCTCTAAAATTCAATCCTAAATTTTATTGTTTTCAGGAGTATTAGAACAAAA
AAACAATGTTACGATCATCTATTTTATCTACGACCATACCCAAGTGTCTGCAAATCATAT
GTCAAAATTCGAACGCGGTATCTGTAGTGCCTGCACTAAATGGTTTTTGGGTTCGTCGAC
AACAAACTCTGCCGGTTGTAGACTCGTCCAAAGTTTTAGAAAAGAAAGGTTACTCACCGT
TTGGCACAAAGCAAGCTTCTGTGGCCGAGTGGTCATTAGCAAGACTCGATGATCTGTTAA
ATTGGGGTCGTAAGGGTTCAATATGGCCATTGACATTTGGTTTGGCATGCTGTGCTGTTG
AAATGATGCACATCGCCGCACCACGTTATGATATGGATCGTTACGGAGTGGTATTCCGAG
CATCACCGCGCCAAGCAGACGTAATTATTGTAGCTGGTACATTGACCAACAAAATGGCAC
CGGCTTTGCGTAAAGTCTATGATCAAATGCCTGAGCCACGATGGGTTATTTCTATGGGAA
GCTGTGCCAACGGCGGTGGCTATTATCACTATTCGTACTCTGTAGTTCGCGGTTGCGACC
GAATAATACCTGTCGACATATATGTCCCAGGCTGTCCACCTACCGCAGAAGCTTTAATGT
ACGGTGTGCTACAGTTGCAGAAAAAAGTAAAACGCATGAAGACTCTCCAGATGTGGTACA
GAAAATAA
ATAAAATCTGAGAATGATAAATTAAATTAAAAATGCCATGAATATTAAACAC
GGTGCAGATTACATCTTTTCAATTTATGAGAAACATTTATGGTTCAAGATCCTTCCTTTA
CAATTTTGGAATATATGCGACATGCACATATGTATATACTAAATACACCGTTAAAATGTA
TAATTCAATAATTTGAAAAAATAAATGTTTGACTCAGTGGTTCTATATTGTTTTAAAAAA
TCTGACAGGCTTAGACCTTAAATCAGCTATAAAACCCATATGATCTGATGGGAAAACTAG
ACGGATTAGAGTGGTATAGTGACAGCGTACTTGAAGTACTGTAGTTCTTGAACAAGATGA
TGGAAAAAGATATTGTATACTCCAAACATTATGAAAAGAGCTGCAGGCTGAAGTTAATGA
CGACATGCAAAAATACTCTAACTTTGAGCCTGAAAACCAAGTCTTTTTACTGCCTAAAGG
AATGGTAATAAAGAATGGCAGACTCAAAGGTAGCACCAAATTGTCAGTCAGTATTTACAG
GGAATAACATTAATATTTTGTTTTTTCAACCTCAAACGCGAAGACAATTTTCAGGTAATA
GTCTTCGTTCATTATGCCCTCAATGAAAACAGGATTTCCCACTCATTTTCTAGTAATGCA
GCCACAAACCATGACACTACCCCCGCTGTTTTTCGCTTTTTACGTCGAATGATTTGGGCT
GAATCGGACTTTCCGTGGTCGGCAAAGAGTTTAGCTTTCGATTCCGGAAATTTTTGAAAA
AAAATTAAAGCATTGCCAGCACGTTGAAGTTGTAGGACAAGCACATTGAAGGACAATGAC
CCAACGCAAAAGGCCCATAAAGAAAGATCTTGGCTGTTATATACATATGTAACTGCCCAA
AAGTCATGGAACCGCCACCCCAACCGTCTGATCTAAGCTCTATTAAAAATTTGTGGAGCT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004