login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG17280
Organism Drosophila pseudoobscura
Gene Name Dpse\CG17280
Product Cytochrome c oxidase polypeptide VIa (COXD, COXE) (By similarity)
GENE MAP
Chromosome pseudo3-mel2R
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig3342_Contig5418 The following contributed to sequence development: bases 1..2580 = Contig3342_Contig5418 516109..518688
PRODUCT
Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex IV: Cytochrome c oxidase
EXTERNAL RESOURCES
GO GO:0006091
Biological process: energy pathways.
SwissProt AC  --
HGSC (Dpseudoobscura) Contig3342_Contig5418
View Sequence REFERENCE SEQUENCE
Contig Contig3342_Contig5418
Sequence Location 516109..518688
Sequence Lenght 2580bp
Relative Gene location 1045 .. 1500
CDS
CDS Location 1045 .. 1500
Sequence Lenght 109aa
Translation MSAILNHAIRRQFGATAARNMSGTAAVAGEHSGGYKVWKRLSFFVAVPAVGLCMLNAYLK
HQEEHDHPRQEFVKYDYLRRREKRFPWGEGNKSLFHNPHVNPLPDGYEH
mRNA
mRNA Location 1045 .. 1500
5'UTR Location  --
3'UTR Location  --
Exon 1045..1141,1268..1500
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGTCTGCTATTCTAAACCACGCAATTCGTCGCCAATTCGGCGCTACTGCGGCCCGGAAC
ATGTCTGGAACTGCTGCCGTGGCCGGCGAGCACTCGG
GTGGCTACAAGGTCTGGAAGCGT
CTCTCCTTCTTCGTGGCCGTTCCGGCCGTTGGCCTGTGCATGCTCAATGCCTATCTGAAG
CACCAGGAGGAGCACGACCATCCTCGCCAGGAGTTCGTCAAGTACGACTACTTGCGTCGT
CGCGAGAAGCGTTTCCCCTGGGGCGAGGGCAACAAGAGCCTGTTCCACAACCCCCATGTC
AACCCCTTGCCCGATGGCTATGAGCACTAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TCCGCTGCATGTCAGCGGGATTTGTCGCAAGTTATTGGCAGCCATTTGTTTATTAAATTC
CTTATCGGTTCGATTCGTTTCGCGGTAATAATACTCTTCGTTCTTACACTTGAAGGAGCG
CAATTGGCAATAATAGGGTTTATTGTCTAATGAGAATTGTTAGGAAACTTGGCTCTTCGG
GTTGCCTTTGTACTTCGGGTTGTGCTAATTTAATATTTTTCACTGTCTTCGCATGCTTTC
AATTCAATTTACAATATGCATGGCCTTGGCGGCTGCTCAGCGGTGCTGATGTTGCTCGTG
CGGTGTCGCGTCACTAACGGAAGCTGAGCTGAGCACTTTGCTTTGTTAACAATATTGTAA
ATACAATTTTAATATCATAGGAGAAATTACGCGATGCCACCAGATTGTTTTGGTCCAGAC
AGTGTACGGTCTGACCCTTCGAAATATACCTCACAGTTTCAAAATATACTGTAAATATAC
TGACAACATACGCGTAAAAAATACTGGAAAATACTATGATAAATAAATAAACTATATTTA
CAAGCAGTTAGAATCGTAATTGCCACATACATACCAGATTTTAGACAAAATCCAATAAAA
GCAAGTTTTTAAAACAACCCAGTCAGGTAGAAAATTGATTTCTTAATCGAATAAAATGAT
GCGGGCAGAGCTGAAAGATCTATCTAGCTAGTATTATTCCAGTGACTATGAAAATCGTTG
AATATGGTTTCCAATCCTCGATGGAGAACGATTAACCCATTGCAAGCCAAGGGTGTATTT
TAATATTCCACCGAAAATAATAAAAATCGAATGATTTTATCGCAATTCAGGCGAAAGATA
TAGTGTTTTTTTTTAAGTTCAGAGGAAAGATGGCATGAATCTACAAGGAGAATTCACAAT
CGTTCATATTTTCCGCCATTTACCTTGGGGGCTTAAGTGGGCTATGCTCGGTTTGTCAGC
ATATGAGACGGTCACACTTGTCATCACTAAACGTCAAAACAGTAAAATTTTCATTCGAGG
AATTGGGATCGATCGGCTGAGAATATGTCTGCTATTCTAAACCACGCAATTCGTCGCCAA
TTCGGCGCTACTGCGGCCCGGAACATGTCTGGAACTGCTGCCGTGGCCGGCGAGCACTCG
G
GTAAATATCCTACCATTGTCCCAAACACCAAATTTCGCAATGTTTGTGGGGTTAAGGTT
ATGTAATTTGGCTGTTAGGCAAGAGGATCGATTTGGGCTCTCCTTAAACATTTGCGACTC
CTTTCAGGTGGCTACAAGGTCTGGAAGCGTCTCTCCTTCTTCGTGGCCGTTCCGGCCGTT
GGCCTGTGCATGCTCAATGCCTATCTGAAGCACCAGGAGGAGCACGACCATCCTCGCCAG
GAGTTCGTCAAGTACGACTACTTGCGTCGTCGCGAGAAGCGTTTCCCCTGGGGCGAGGGC
AACAAGAGCCTGTTCCACAACCCCCATGTCAACCCCTTGCCCGATGGCTATGAGCACTAA
GTGGACGCCCGCTTAGTCGCGATTCCGTTGGGGGTGAAGTGAAGGATGGACTTTTTTTGG
GTTATTGCTGGCCGGGCGCATGCACACATTCTGATGCTGTGGGAGACTTGTATTTAATGT
TAATCTAAATTGAACTCAAGGCGGAAATACACACACACATAAACACAAACAAGCTACCAA
TACAAACACTGCGGTTGGATCCTTGAATAAAGAACTAAAACAATGTAACGCTCCTCCAGG
CCAGAGTCGATGCGGTTCGTTTAATAAGTACGCTATAATTAAGTTTTTATGGGTAATGTT
ATATTATTGCCTAGAATTTTTCGATGAATTCCCGTTTTTGATCAGCAAACGTCCCTTTTT
GGCAGGAGCTACAGGAGGACTCTTCCTAGTCGCAGCAGCCTGTTGTCTGGATTTCTGCGA
ATTTTCGGGTTGATCTTTTACGAGATCTGAAATCCGTGCCTGTCGTGTACGTTTGGGAAA
AACAAGGGTTTCAGTTTCCGCGTCTGGCTTCTCCTTTGGTGGATTTACTTTGCGTTTTTT
CACAGGTGGCGGCGGGGACGACGAATCATCACCCACGGGTTCATCGCGCAGCAGTTCTTG
CAACAAATATTTCTGCTCTTCCTCGTCGAGATCAGCGCAATTTACAAGTATATCTGGGTC
CGCATCACTCTGGTTCGAAACCCTGTCGCCATCATTCTGATACATGTCCATGTCCAGAAC
ATGCTCATCTTCGATGTGTTTCTGCAGGCGATCTGAGCTCAGGAAGATCAAGTCGCAAAA
TTCGCAGGCAAATCGCTCGCCCTCCTTGTGCGTTGTCATGTGCTTCTCCACCGCACCGAT
ATCATTGATCTTTTCATTGCACAACGGACACTTTAGAGACACATTCGCATGGCGGACCGA
GTGCTCTATGAGACTGTTAAAGCTCTGGTGCGACTCCTTGCAGATGCTGCAGACAAACGA
GGCCCCCGCATCCTGCTTGTGCATGCGCAGGTGCCTAGACAGATGGTGGGAGAGAATATA
CGATTTGGAGCAGTATTTGCAGGGGTAGGCTCGCTTTCCGGCATGGGCCACCAGGTGACG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004