login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG11015
Organism Drosophila pseudoobscura
Gene Name Dpse\CG11015
Product Cytochrome c oxidase polypeptide Vb (COXB) (By similarity)
GENE MAP
Chromosome pseudo4-mel2L
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig6773_Contig6970 The following contributed to reference sequence development: bases 1..2940 = Contig6773_Contig6970 398131..401070
PRODUCT
Function This protein is one of the nuclear-coded polypeptide chains of cytochrome c oxidase, the terminal oxidase in mitochondrial electron transport.
Subcellular Location Integral membrane protein/mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex IV: Cytochrome c oxidase
EXTERNAL RESOURCES
GO GO:0007585
Biological process: respiratory gaseous exchange.
GO:0004129
Molecular function: cytochrome-c oxidase activity
SwissProt AC  --
HGSC (Dpseudoobscura) Contig6773_Contig6970
View Sequence REFERENCE SEQUENCE
Contig Contig6773_Contig6970
Sequence Location  --
Sequence Lenght 2940bp
Relative Gene location 1005 .. 1951
CDS
CDS Location 1005 .. 1951
Sequence Lenght 120aa
Translation MASICGRMALRAAARQNVTYAPVRFCKMMNDPLEHATGIEKRELLAKAAGNENPFDMKVF
KRGAGTKENPNLIPSAFDARIVGCICEEDQTYVQWMWLQKGNQKRCECGHWFKLVEKAAV
mRNA
mRNA Location 1005 .. 1951
5'UTR Location  --
3'UTR Location  --
Exon 1005..1086,1607..1780,1845..1951
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGGCATCGATCTGTGGACGCATGGCGCTTCGTGCCGCTGCACGCCAAAATGTTACATAC
GCGCCCGTGCGTTTTTGCAAAA
TGATGAACGACCCCTTGGAGCATGCCACGGGTATCGAG
AAGCGTGAGCTGCTCGCCAAAGCCGCCGGCAATGAGAATCCCTTCGACATGAAGGTGTTC
AAGCGCGGTGCTGGCACCAAGGAGAACCCCAACTTGATTCCATCGGCCTTCGATGCCAGA
ATTGTTGGCTGCATCT
GCGAAGAGGATCAGACATACGTGCAATGGATGTGGCTGCAGAAG
GGCAACCAGAAGCGTTGCGAGTGCGGCCATTGGTTCAAGCTGGTGGAGAAGGCAGCTGTT
TAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
GTCATTCGTCTTGTCCTGCAAATACTTATCATGCCAGATGTAGCCGGAGCCAATGGCCAG
GATCTTCCCGCCTTTGCCATTGGTATAGTAGCCCGCCAGTGGACGATTGAAGGGATACAC
CACGGGGCCTGTGGTGAGCAGGACATTGGCCGGCTCGGAGACATTCAGGGTGGCTCCGTA
GGGATACTGAAAGTGTATCTTGTACTTCTCGTCGCTGAAGTCGTAGTCGACCTTCTCAAT
GTCCAGCTTGATGAGGTGCCGCCACATGGACTCGCAGACCACTCCACCACCCACAATGCA
CTCTTTGGGATGAAAATTCTTGTAGTAGTGCGGTCGCACCACATTGTCCCCGTTGATGTA
GATCCCGTACTGCTCCAGAAAAAAATTCACGTTCGTGTTGAACTCCTGTTCGCCGCCCTC
GCCAAGGAGAACCAACAGACTGCCTCCGTCCACCTCCACATAGTGTTTGAGCACTTCGAA
CTCATCCTCGGTGAAGCGATCCTGGGGGCCAGCCAGGACGAATATCTTGGCACGCGAAAG
GTGCCCTTTTTGCAGTTCGGCATCGCTTCTAAGGGTGTTCAATATTGTTTGTTTACCATT
CAAATTCGAATCTTTTGCCTTTATACTGACTGTTCCACGTTCCAGTTGGCCTTCAGCTTG
CGGTGAAGCATTTTATAGTTGTCCGATATTTGAAATCGCTCATTTTTGGATGTATCAAAG
CAGATAATAGGTTTATTAGACATCTTTACTTTCAGATTATAATAAATTTCCTTTTGGTTT
GTTTTGCATTTTTCCGTTGCCCGGACAACTGTGCGCCACCTAGCGGTTCAAGTGGCAGCA
CAGTTTCCTGCCAGTCTGGTAACCTCTGAAAACTGTAGAACGTTTCACAACACCTGCCAT
CGCGGTACTGCTGCACACTGTCCTTAAATCTCGCTGTGTGAAAAATTACGAAAGAATTTT
TGGTGTTCAATTTTTAGGAACCACAAATTTTCGCGAAACGAACTATGGCATCGATCTGTG
GACGCATGGCGCTTCGTGCCGCTGCACGCCAAAATGTTACATACGCGCCCGTGCGTTTTT
GCAAAA
GTAAGTGCAGAAATCAAACCGAAATCCCCTGCGCTGCCGTCACGTCCGCCCGTC
GTGGTGTGTAGATTTTGGTGTGAAGGCACTTCTGCGTCCGAGTTTCATGGCTAGGATTGC
ATAATATGACAACCAATGCAATGCCAGAACACAGTCTGCGGCAGCCCCCTGCATCTGGAG
CAGCAGTTTTTGGCAATTGAAAATGCGCCTGCTTCGGTGGGGAGGTTATGTAATAACTAT
GCGCAGGGAAATGTGTTTTATGTACACACGGCGGGGGGAAAGACGAGACGGCAACGGAAC
GGCAGCGATACGCAGTTCGCACCTCAACTCTGCACTGTAACTCTATCGGGGGCTAAGCTA
ATGACATTTAATAGTTAGCCGATGACACAGCCGCAGAGGTTCGGGCGTTTGCCGTTTATG
TAACCTCGGGCCGGATCGCTGCTGCACAGCTGATCCGAGTCCCAGACGAAGAAGCTTATC
AATAGAGGACACAATCAGTTAATTGCCATTCCATTTCCAATTGCAGTGATGAACGACCCC
TTGGAGCATGCCACGGGTATCGAGAAGCGTGAGCTGCTCGCCAAAGCCGCCGGCAATGAG
AATCCCTTCGACATGAAGGTGTTCAAGCGCGGTGCTGGCACCAAGGAGAACCCCAACTTG
ATTCCATCGGCCTTCGATGCCAGAATTGTTGGCTGCATCT
GTGAGTAAATGCCATCCCGA
AACAAGGAAACCCATACTAACTTTATTCCAACTTTATTTTGCAGGCGAAGAGGATCAGAC
ATACGTGCAATGGATGTGGCTGCAGAAGGGCAACCAGAAGCGTTGCGAGTGCGGCCATTG
GTTCAAGCTGGTGGAGAAGGCAGCTGTTTAA
AGTTATTATTAATTAATTAAATAAACCAA
TTAATAACAAGAACACACCACACAACAACTACTAAGCTAAAAGTCAACCAACACCTTAGC
TGTCCAAATAAAAACAGACATCAAATCCAGAAAAAACAACCAAATAACCAACCTCGGCGG
TGATCAAGGGGGCAGGCAGCAGCTCTTCCCGTTTTCAGTTTTAAATCTTTCATTTCCACC
GCAGTCAACGTTAATCCAAGGAGCGATGCTTAAGTATATATCAGATAAACGAACAATAAA
GGCAACAAAGTGATTTTGAGCGAAAGTAAATCGAAAATGCGTCTCAATGAAGCGATGGAA
AAATTTTAGATCCCAGTAGGCCCTACTTTACAACCAAACGAATGTGTCCTATCGACTGTT
TAGAATCATTCCATTCGAAACTGTGAAACAGACAACTTTCACTCCCAAGCAAAACAAAAA
AAAATTATTTTTGTGATATTCCGTGATTAAATTGCTGTTTTCGTCAGAATGTCATCGTAT
TTGGCACGTCTGTTGAAGGCTCAGACCGCCTCCAAACGACTCGTCTCGCAATTGGTGCAG
CGCAAGGGAAAACTCAGTTCCCTGCTGCAGCGCGTGGGACTGAAGAAGTGGACGGATACC
GCCGCCGCACGAGCAATCTCCACAACTCCAGTACTAAAGGCGGGTAAGTGGAACCTGCTG
GTGCAGCCTGAGATAAAAGAACAACAGAGCTCAAGCCACAACCCACCCGTCAGAAATGGC
CGATGACATGGAACTGGCCACCGGTATCGCTAAGCGTGAGATGCAGCTGAAGGAGCAGGG
CTGCGGTGATCCCTGGGGTCTAGGCAAGATTCTAAAGCGGGGCTCTGGCAGGCTGAACGA
TCCTACCGAGATACCCTCGGCATTTGATGGTCGCCTCGTCGGCTGCCTGTGCCTGGACGA
CCGTTTCGCCAAGTGGATGTGGCTAGAGGAGGGACCACCGAAGCGCTGCGAATGCGGGCA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004