login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG9172
Organism Drosophila melanogaster
Gene Name CG9172
Product NADH-UBIQUINONE OXIDOREDUCTASE 20 KDA SUBUNIT (NUKM) (By similarity)
GENE MAP
Chromosome X
Citogenetic Map 14A5
Gene Map
Comment This record is derived from the following: AE003500 RE33005.5prime BI236876 gb|AY061393|LD31474 full length cDNA Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Unknown
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0006120
Biological process: mitochondrial electron transport, NADH to ubiquinone.
GO:0016655
Molecular function: oxidoreductase activity, acting on NADH or NADPH, quinone or similar compound as
SwissProt AC  --
FLYBASE FBgn0030718
View Sequence REFERENCE SEQUENCE
Scaffold AE003500
Sequence Location  --
Sequence Lenght 2880bp
Relative Gene location 997 .. 1954
CDS
CDS Location 1127 .. 1792
Sequence Lenght 221aa
Translation MLRSAMMSSTLSRALQKATQTPNASISALPALNLALVRQQQTLPVAEVAQNLPKKGYSPF
GTKQSSVAEWSLARLDDLLNWGRKGSIWPLTFGLACCAVEMMHIAAPRYDMDRYGVVFRA
SPRQADVIIVAGTLTNKMAPALRKVYDQMPEPRWVISMGSCANGGGYYHYSYSVVRGCDR
IIPVDIYVPGCPPTAEALMYGVLQLQKKVKRMKTLQMWYRK
mRNA
mRNA Location 997 .. 1954
5'UTR Location 997..1065,1117..1126
3'UTR Location 1793..1954
Exon 997..1065,1117..1954
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
AGTAGTTCGGCGGCGGTCACATCATACGCATCCCCTATAAATCGAAATAAGTTGAAGTTA
CATAAATAG
CAGGATCAACATGCTGCGTTCGGCGATGATGTCATCGACCCTGTCCCGGGC
TCTCCAAAAGGCGACTCAGACACCGAATGCGTCGATTTCGGCGCTGCCCGCTCTGAATTT
GGCCCTGGTGCGCCAACAACAAACGCTTCCAGTTGCCGAAGTGGCCCAAAATCTGCCCAA
GAAGGGCTACTCTCCGTTCGGCACCAAACAGTCCTCCGTTGCGGAGTGGTCACTGGCCAG
ACTGGACGATCTGCTCAACTGGGGTCGCAAGGGCTCGATCTGGCCACTGACTTTCGGTTT
GGCCTGCTGTGCCGTCGAAATGATGCACATCGCTGCTCCGCGTTACGACATGGATCGATA
TGGTGTTGTGTTCCGTGCATCTCCACGTCAGGCCGATGTCATCATCGTCGCTGGCACGCT
GACCAACAAAATGGCACCGGCCCTGCGAAAGGTCTACGACCAAATGCCCGAGCCACGTTG
GGTCATCTCCATGGGCAGCTGTGCCAACGGCGGCGGCTACTACCATTACTCGTACTCCGT
CGTCCGTGGCTGCGATAGGATAATCCCCGTCGACATATACGTACCCGGTTGTCCGCCAAC
CGCCGAGGCGCTCATGTACGGCGTTTTGCAGCTGCAGAAGAAGGTTAAGCGGATGAAGAC
GCTCCAGATGTGGTATAGGAAGTAA
GGCAACGATCGGAACTTATATTTAAAATGTGAAAC
ATCAAACGACATACGATTTTGCGAACAGAAATCATATTAAATATCGTTCTGTTAACGTTC
AGTTGTTGTATACATTGTTTGTTGGATCACGAGGATATTGCAAATAAATGCCTTTCGATA
TAAATAC
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TGGATATTATTAACAAGGCTCCATTGGTTCTCGCCGAGCTGCTTTTCACTGAAAACATCA
TCAAGGACGTGCAGAAGAATCGCCCTTTGCTTCTTCGCTTCACCCTCAATAATCCAAAAG
CACAGCGCTATCTAATTGGTGGAGTGGAGCAAACTGTAGAGCTGCATAAGGGTATATTGA
TGAGCAAGGTTGCTGGAATCTTCAAATTGTTTTATGATCTGGACATACTCGATGAGGCCG
TCATACTGGAGTGGGCACAGAAGGTTAGCAAACGACATGTCTCGAAAAATATTGCTGCCG
AAATACACGAGAAAGCTATGCCATTCGTTCTCTGGCTGAAGAATGCCGAGGAAGAGTCCT
CCGAAAGTGAGGAGGAGGAGGACGATGAATCCGAGGAGGATAACTACGTTTCCAGTGCCG
GCCAACGTGGCGGTCAACGGGTCGTCCAACGCGGAATTCCACGCGCTGTTGCAGGCGACG
AGGATGACGAGGACGACGTGAACATCGACGATATCTAAAAGGAATCAAAAAGAGAACAGC
TACCCTAATCCAACCAGTAATATTTTAAAAGGGGGAAAATCAAGCGAGCAAGCATAATCT
ACAATTCAAACTGAAATATAAATTAGCGAGTTAAATCAACATGTGGTTTTTTTTATCTTT
AGTTCTTAAGAGTGCTAATCGTATTTTGAGTCGTCGCTTTACTACCATTCAATTGTTTGC
ATAACATTTCCCAAGCCGCTGTAACAATAGAATTACACCAACATATTACAAAATAAAGCA
AACAAAAACATTAATAACTACTTTTTTACTTGCCTTTTGGTCAGCTTAAGCTATGACCTT
CAAGCAAGTTGATTTTTTTAGCCAACCATTGCGTTCATGTGGGAAAAGGGCATAAAGTTC
ATGCTGCCGCAAGTGATGTGCTTGTGTGAGAATAGGATATCTAAAGTAAATTCGTATTTT
ATAGTATATTTTCCTGGTGCATTTGGTATTTTAGTTAGTAGTTCGGCGGCGGTCACATCA
TACGCATCCCCTATAAATCGAAATAAGTTGAAGTTACATAAATAG
GTATTAAATGTTTAA
ATGCCCAGTCCTAGTATAACTACAGATTTACTTTAGCAGGATCAACATGCTGCGTTCGGC
GATGATGTCATCGACCCTGTCCCGGGCTCTCCAAAAGGCGACTCAGACACCGAATGCGTC
GATTTCGGCGCTGCCCGCTCTGAATTTGGCCCTGGTGCGCCAACAACAAACGCTTCCAGT
TGCCGAAGTGGCCCAAAATCTGCCCAAGAAGGGCTACTCTCCGTTCGGCACCAAACAGTC
CTCCGTTGCGGAGTGGTCACTGGCCAGACTGGACGATCTGCTCAACTGGGGTCGCAAGGG
CTCGATCTGGCCACTGACTTTCGGTTTGGCCTGCTGTGCCGTCGAAATGATGCACATCGC
TGCTCCGCGTTACGACATGGATCGATATGGTGTTGTGTTCCGTGCATCTCCACGTCAGGC
CGATGTCATCATCGTCGCTGGCACGCTGACCAACAAAATGGCACCGGCCCTGCGAAAGGT
CTACGACCAAATGCCCGAGCCACGTTGGGTCATCTCCATGGGCAGCTGTGCCAACGGCGG
CGGCTACTACCATTACTCGTACTCCGTCGTCCGTGGCTGCGATAGGATAATCCCCGTCGA
CATATACGTACCCGGTTGTCCGCCAACCGCCGAGGCGCTCATGTACGGCGTTTTGCAGCT
GCAGAAGAAGGTTAAGCGGATGAAGACGCTCCAGATGTGGTATAGGAAGTAA
GGCAACGA
TCGGAACTTATATTTAAAATGTGAAACATCAAACGACATACGATTTTGCGAACAGAAATC
ATATTAAATATCGTTCTGTTAACGTTCAGTTGTTGTATACATTGTTTGTTGGATCACGAG
GATATTGCAAATAAATGCCTTTCGATATAAATAC
AAACATTCAAGCTGTGCTTCTGTATC
CAAACGTCAGCTTGAATCGTACGTGTGTTTGCCAACGGTCGTAATGAAAATCGTGAATTC
GAAAAAAGTTTTGTTTCCCTTCAAAATGAGCGTGAAGTTAACGGCTCCTTCCTCTTTTTT
TTATCGTGAATTGTATACACAACCATATCATTTAGTTGTCATAGAAACGATCGCACCAAC
CACAGGACAATCTGCTGTTTTTACTTAATTTTTCTGTATTCATTTCAAGGTCCTGACGTT
TTCGGGACACAAAGTGCAAGAATATAAGCTCAGTTTAAAGTGTTTAAAATAGTTATATTT
TTTAATTGGCAGATTTTTTTTTAACGCAACTGCAGAGTAAGCAAACCCTTAAAATACAAT
TATTCATGCTAACGTCCCAATAAACCCAACGAAAAATACAAAAAGAAATAAATATTTGTA
TAATTTACATATGCAATATAATTTGACTAGCCATTAACTAGTCTTGTGAATTCTGCCCAA
GACTAATCTCCCCCATTTCGGTACTGGAAAGGCTTGGCGACAAGGTCGTGGACCTGGAGT
TGCAAGCATTCTCATCCAGATTATAGTAATTCACTATTCGCTGTGGTGGTCGGTTGGAGA
TGACCTCTACGATTTGATTCACAACCCATTTGGTCAATTTGATGACGGCCACGTGTGCCG
CAAACTGCAGGATCATGGCTCCAAAGCCCTTGTAGAGGCCACTAACTCCCTCGGAGACAA
TCGTTGTCTGATAGCAATCGACGACTCCTTGATAGTTTGTTAGAATGGGTACGACATCGT
AGCCATTGTCGAGGTTGTCGATTATAGTTCGTGTTCCCTGCAATTGCAGACGGTGTAGAA
TCGTTTCGAACGGGAAGAACATGACCTCAGTGGTTATGATAGCAATAAGGCTGGCATAGA
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004