login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG_EG19249
Organism Anopheles gambiae str. PEST
Gene Name agEG19249
Product NADH-UBIQUINONE OXIDOREDUCTASE 19 KDA SUBUNIT (NUPM) (By similarity)
GENE MAP
Chromosome 2L
Celera Gene agCG57000
Citogenetic Map 26A-26D
Gene Map
Comment This record is derived from the following: gb|AAAB01008807.1 gb|BM575553 5', mRNA sequence gb|BX042335 5', mRNA sequence The following contributed to reference sequence development: bases 1..3155 - AAAB01008807.1 9366228..9369382
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0005739
Cellular component: mitochondrion.
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000019249
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008807.1
Sequence Location 9366228..9369382
Sequence Lenght 3155bp
Relative Gene location 1001 .. 2187
CDS
CDS Location 1001 .. 2187
Sequence Lenght 175aa
Translation MVVTKDTFLPTEEELTVPEINLSGPALRAGAFHLGKYCEAQNNEFMLCRQELDDPRACVN
EGKAVTNCAFEFFRKLKKTCAQEFTQYANCLDKSSGDLNFKHCRKTQGVYDKCVLDNMDL
ERPDYGYFCRAKVHATERPPPPKKEKAVYPDATPGLPEDYPRPEAKYGSRFHWLN
mRNA
mRNA Location 1001 .. 2187
5'UTR Location  --
3'UTR Location  --
Exon 1001..1110,1173..1324,1479..1654,1720..2187
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATTTTTACCACTTCAATTTTCGTACAATTCCTTCGTCAGCTGCGAGGATAACTACTCGCA
TCGCGTAAATTGAATTCCCCTGTACGTGCAGGGGACAAACTCAGCTGCAG
TTGTATTCGG
TCGCTCCGGCACCATGGTTGTGACGAAAGATACGTTCCTGCCGACGGAGGAAGAACTTAC
GGTACCGGAGATCAACCTATCCGGACCAGCGCTCCGTGCCGGCGCCTTCCATCTGGGCAA
GTACTGTGAGGCGCAAAACAAT
GAGTTTATGTTATGCCGCCAGGAGCTGGACGATCCGCG
GGCGTGCGTGAACGAGGGCAAAGCGGTCACTAACTGTGCGTTCGAGTTCTTCCGGAAGCT
AAAGAAGACATGTGCCCAGGAGTTTACGCAGTATGCCAACTGTCTCGACAAAAGCAGTGG
CGATTTGAATTTCAAGCA
CTGCCGCAAAACGCAGGGCGTGTACGACAAGTGCGTCCTGGA
CAACATGGATCTGGAGCGTCCCGATTATGGATATTTCTGCCGCGCCAAGGTTCACGCCAC
GGAACGTCCGCCGCCACCGAAGAAAGAAAAGGCAGTGTACCCGGACGCAACGCCGGGACT
GCCGGAGGATTATCCACGGCCCGAGGCCAAATACGGTTCCCGATTCCACTGGCTCAACTA
GGGGTGAGGTGGGAGCGCGTGGCAGATGGGGTTCTACACGGTACGGTTTAGCTGAAATGG
TTCTAGGCAAAGCGGTGACGAGAGCTCGCTGAACGTTGTTTGAGTGTAGATAAGGAACGA
GAGAGAGAAAGAGAGAGGGGCTCTAGCCCGCACGCATGATGGTGTAGAAAACAGCACACT
CAACACCATAATCGACCATCGGATGAATCGTTTCTTTAGCTACAGTAAAAATCATTGCTT
AAAACA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TCCAATTGGATCCCAGTAGGATGTGTTGGAAAATGATTGGAAACTTGCGATGAGAAACGT
ACTAATCGTTGCAAAAAAAAAAAAAAAAAAAAATGATAGCTTTCTTGCTCGAGAGAAACA
TGAATAATTTAAGTAAAGGGGCTTTACGAGAATGTTCAAGCAATAAATGAAATTTACTTG
GCAAAAGGCATTTTTTCTCTACCTATGTTACATATATTTGTCGCAACAGCAAAGTAGTTC
CTAGCGGCAACTTCTCCCCCTCCTCCCACCACCCGGTTTGCTAACCAAAGTGGAATATTA
TTCGGAGATTCGAATCACATTCAGGATAAATTCGAAGAAAAAAAAATTAAAATTAAAAAA
TTTAAAGTTCCAAACACTACTTAGCATTAGTATTTTTAAACACTAATCCGGAAGAATCCC
ATCAGTTTTAAGTAGTGCTTATCGAACCTGCTTTACGCTTTACGTTCCATAGTGCACAGT
GCATGAACCCACACCGAACATGGTTCTAGGTCGTACGACTTCACAATTTTACCACAAGGC
CATTTTCACCATTCAACATTGATCCATCGATGACTGTTAATTGGCAAAGAAATGTTACAA
GCGTACATATAATTAGATAATATCAGTAAACGCTGAACAAAGTGGAGCGATTTAATAAAA
ACATAGGGATGGAAATTTGCAAATTTAATCAAAGAAAAACATAAAAATACACACTTCATA
TAAAAATATGTAATAAAACTAATACTGATAGCCTGTTCCTTGAATAGAAGAACGTATTTA
TGATTAGTAGCTCTTCTTAAAGTCAGTGTGGGACAATTTTCAACACGTCTACGTGAAATT
TGCACAAAACGGTTCCATTCGAAACATCGAATACAAAAACAAACAATCAACCCTCAATGT
AATCAGCCTTCATTCCAGCCCTGAACGTTTTATGACGCACGCATCTCACGCACACCACTG
CAGCAGCGCTGTCAAACTTCTGTCATTCGTATTGAACTTTATTTTTACCACTTCAATTTT
CGTACAATTCCTTCGTCAGCTGCGAGGATAACTACTCGCATCGCGTAAATTGAATTCCCC
TGTACGTGCAGGGGACAAACTCAGCTGCAG
GTAACATTTGCCGTTTGCCGTAAACATTTT
CATACCTCTCTAACGATGAGCGCTCATTGCAGTTGTATTCGGTCGCTCCGGCACCATGGT
TGTGACGAAAGATACGTTCCTGCCGACGGAGGAAGAACTTACGGTACCGGAGATCAACCT
ATCCGGACCAGCGCTCCGTGCCGGCGCCTTCCATCTGGGCAAGTACTGTGAGGCGCAAAA
CAAT
GTAAGTGGTCCCCGGAAGGCAAACAATCGGCCCCAATCCTTTGCCCGAAGGGAAGA
GAAGTCGGAATCTTTCCTGCTTGTTTTGTTATATAATGGTGCTCAATCCATAACATAACC
TGACGTTCCTTCCGTCGGTGTTGTTTACGTTTCGGCAGGAGTTTATGTTATGCCGCCAGG
AGCTGGACGATCCGCGGGCGTGCGTGAACGAGGGCAAAGCGGTCACTAACTGTGCGTTCG
AGTTCTTCCGGAAGCTAAAGAAGACATGTGCCCAGGAGTTTACGCAGTATGCCAACTGTC
TCGACAAAAGCAGTGGCGATTTGAATTTCAAGCA
GTGAGTGAAGAGTGTGTGCCAAATTA
CCAATGCATTACTTAAAAACATGTTCCAATGTATTGCAGCTGCCGCAAAACGCAGGGCGT
GTACGACAAGTGCGTCCTGGACAACATGGATCTGGAGCGTCCCGATTATGGATATTTCTG
CCGCGCCAAGGTTCACGCCACGGAACGTCCGCCGCCACCGAAGAAAGAAAAGGCAGTGTA
CCCGGACGCAACGCCGGGACTGCCGGAGGATTATCCACGGCCCGAGGCCAAATACGGTTC
CCGATTCCACTGGCTCAACTAGGGGTGAGGTGGGAGCGCGTGGCAGATGGGGTTCTACAC
GGTACGGTTTAGCTGAAATGGTTCTAGGCAAAGCGGTGACGAGAGCTCGCTGAACGTTGT
TTGAGTGTAGATAAGGAACGAGAGAGAGAAAGAGAGAGGGGCTCTAGCCCGCACGCATGA
TGGTGTAGAAAACAGCACACTCAACACCATAATCGACCATCGGATGAATCGTTTCTTTAG
CTACAGTAAAAATCATTGCTTAAAACA
ACGAACTATGCTGAAGGGACTGATTGTGTAGCG
AAAGAATGACGCATGCGGTATGGGATGGGGATTCCTTCTGTAGTATGGTAGACATTAAAT
ATTTAGGAACATGTTAGCGTGAAAAGGCACAAAAACAGACAGCTTTGGAAAGAAAATTAC
TCCCTTTATGATTGTGAATTACAGGGAATTCCATTCTATTAATCATATTAGAAATTGGAT
TGATTCTCCATAGACCTTCCCACATGTTGGTCTCATTCAATTCGTAACAGTCTTTGGAAC
AGAAACCCTTTGCTGGATTGCTGCCTCTCTTTCTTTAGCAGAAGTGATGAACCATCTGTA
TTTCTACTATCTGCTGGGAGTGATGAATTTCCGTTACGATAAAGCTAAAGAATCGTTTAC
CAGCAGCAAGACGATGACCGCACTCAAGGTGGTGCTTCATATAGTTATTCCAAATTCGGT
GCTGTTAGTAATTTCGCTCATAGGAACAACGGGTATACTACTTACCATACCGTCCGTACA
CGTGGTAGCGTTTGCCATGCGCGTTATCTGGACGCTGCTGACAATGAACATTACCATACT
GCTGAACTATTACTTTACCGGTACAAAGCAACGTGCACTGCTAACCGAATGTGTGGCATG
CTTGCGAGAAGCGAAAAGCGAAAGTACAGTTGAAAGTGCTCAAAACAGTCCGTTTCGCGG
TTCAAGGGTCGTGCTGGGCGTGTTCCTGCTGCACTACATCAACTACGAGCTAAACCAGTA
CACGTACGTGCTGCTGTACGATGAAAAGTGGCCCGAGCTTATGTTTTACATCATCTTTTA
CTACCTGGAGATGGTAACGGTCATGAATGCACTGTACTTTTCCACCGTGCTCGATATCGT
GCATCGAACGGGGCAGCTGGATAGCGATCGGTTGTCCAGGTGTTTGCAACGAAATGCCAC
GAGCGAGCCGACCGAGCTTGATGATCCATACTGGT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004