login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DP_CG3683
Organism Drosophila pseudoobscura
Gene Name Dpse\CG3683
Product NADH-UBIQUINONE OXIDOREDUCTASE 19 KDA SUBUNIT (NUPM) (By similarity)
GENE MAP
Chromosome pseudo3-mel2R
Citogenetic Map  --
Gene Map
Comment This record is derived from the following: Contig251_Contig3345 The following contributed to reference sequence development: bases 1..2220 - Contig251_Contig3345 302223..300004
PRODUCT
Function Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0005739
Cellular component: mitochondrion.
SwissProt AC  --
View Sequence REFERENCE SEQUENCE
Contig Contig251_Contig3345
Sequence Location 302223..300004
Sequence Lenght 2220bp
Relative Gene location 462 .. 1279
CDS
CDS Location 462 .. 1279
Sequence Lenght 175aa
Translation MVITNNTTLPEEAELNVQELNLSSAAMRAGAFHLGKQCEQENNEFMLCRQELDDPRACLG
EGKAVTSCALNFFRKVKKTCHEEFMQYATCLDKSSGTMAFAQCRKTQGVFDKCVKDNFDW
ERPSYGYFSRAKVIQSAREAPKKEEIKSYPDATPGLPEDYPKPPAKYGSRFHWLE
mRNA
mRNA Location 462 .. 1279
5'UTR Location  --
3'UTR Location  --
Exon 462..590,769..944,998..1088,1148..1279
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
ATGGTCATAACCAACAACACAACGCTGCCAGAGGAGGCTGAGCTCAATGTTCAGGAGCTG
AATCTTTCTTCAGCGGCTATGCGTGCGGGTGCCTTCCACTTAGGCAAGCAATGCGAGCAG
GAAAATAAT
GAGTTTATGTTGTGCAGGCAAGAGCTGGACGATCCGCGTGCCTGCTTGGGG
GAGGGAAAGGCGGTTACCAGTTGCGCCCTAAACTTCTTCCGCAAGGTGAAGAAGACCTGC
CATGAGGAGTTTATGCAGTACGCCACTTGCCTGGACAAGAGCAGTGGTACAATGGCATTT
GCACA
GTGCCGCAAGACCCAAGGTGTGTTTGACAAGTGTGTTAAGGATAACTTTGACTGG
GAGCGCCCTTCTTATGGCTACTTTTCCAGGGCCAAG
GTCATTCAATCTGCACGCGAGGCT
CCCAAGAAGGAGGAGATCAAATCGTATCCGGATGCCACCCCCGGCTTGCCCGAAGATTAC
CCCAAGCCTCCAGCCAAGTACGGTTCTCGCTTCCACTGGCTGGAGTAG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
TAATACTATTTATATAGAACATTTAGCCATGCCCACGAAATTTTATACGATTGATGAATC
GATTCTATACATGATTGGCCTATTCGAAATACTTGCATTTATTGGATTTTTATATAAAAT
TGAAAATTAAATTAATAGATGACAATAATACCATTTAGCACTAAAAAACACCTCATGGGA
GCGCGGCGAAAACCAGTTTCTACAGTATATACGGTCTCACTTGAAAAATATACCGAGTGG
TGCGCGCCAAATCGAAGTTTTTTTATAATTTTATCCGATTAATAATATTTACATACTAAT
GTAGTTAATATGTTGCAATTTGTAGTTAGCGTGTAGTTACCTTAATCTAGTCAGCTGTTG
TGTTTTGTGTCTGGGTATTGAAATTTAAATATTCACATTTAATATCAATTAAACCGATCC
TTGCAGACAAATAGAACAGAGGGAAGAAGATAAACTTCGCCATGGTCATAACCAACAACA
CAACGCTGCCAGAGGAGGCTGAGCTCAATGTTCAGGAGCTGAATCTTTCTTCAGCGGCTA
TGCGTGCGGGTGCCTTCCACTTAGGCAAGCAATGCGAGCAGGAAAATAAT
GTTAGTGCAT
TTATTTTACTTCAGATTAATTCTATATATGAGTCTTTAGCTGCTGTGCAACGAAAACATA
AATTAAGATCGGTCTGGACACCAAAATTGGTCCGCTTCAGTTATATAACCTAACCTCAAA
ACCCCACCGTTCTGGGTTTGTTTACGTTTAATTCATTTGTAATTTCAGGAGTTTATGTTG
TGCAGGCAAGAGCTGGACGATCCGCGTGCCTGCTTGGGGGAGGGAAAGGCGGTTACCAGT
TGCGCCCTAAACTTCTTCCGCAAGGTGAAGAAGACCTGCCATGAGGAGTTTATGCAGTAC
GCCACTTGCCTGGACAAGAGCAGTGGTACAATGGCATTTGCACA
GTAAGTTAAAGGTCCA
CTTAGTATCAAAAGATGCTCATCATTCGCTATTTTAGGTGCCGCAAGACCCAAGGTGTGT
TTGACAAGTGTGTTAAGGATAACTTTGACTGGGAGCGCCCTTCTTATGGCTACTTTTCCA
GGGCCAAG
GTAAGTGAATCGTCAAAATCATGTTTATTAAATGTAACACATTAAATTATAT
TACCCAGGTCATTCAATCTGCACGCGAGGCTCCCAAGAAGGAGGAGATCAAATCGTATCC
GGATGCCACCCCCGGCTTGCCCGAAGATTACCCCAAGCCTCCAGCCAAGTACGGTTCTCG
CTTCCACTGGCTGGAGTAG
ACAGCTGCTATTGTATAGTGAAATTGAAAGCGATCATCTTA
ACATAAACTATTGTTTCCATTAGTACTTCAATGATTTTATTTTATTTTATCGCAATTTCG
TTCTCGACAGAGTTTGCTTAATCTTCTTCATTATATCCAAGTACTGATTGTTGAGGCAGC
AGCCGCAGTAGCTTACTGGTAAGCAAGCACTTCCCTCGATGCGACGATGTAGTGGCATGT
TTTGATAGAACACCCATGATATGTTCTCCTCGCCGAGCACCAACATGATCTTGTCGAAGC
GACAGCCCTCCACCTTGAAGAGATCCACGTCCCCGGTGATAATGCGCCACTCGGAGTAGC
GCAGATTAACACCAGGTGGAAGTTTCGAATGTTCTCTTAGCATTACATGCTCGAACCAAT
CACGGACTTGTACAACTGACCCTGTTGGAGGGTGTTTTCTAATCTGATAGCTGATGCGTG
GATATAAAGGATGGCTGTGGATTGGAATTCCTTAATGATATCGCAATACTTGGAATCTAT
GTTGGGTACTTACATATATGGCACATACGACAGGCGAACTAAAACGAATTCAACTTTTTC
ACGCGGAGCCATCTTATTAATATGTGTATTCGATTTAGAGCGCTTGAAACGCTTCACAGA
CACTGCTAGGCAATACTGAAGAACAGACATTGTCTTCCAGTTATATATACCACATCTTAC
AGGTAGAATCTTTCACTTGCAGGGCCTATATGGCAGATGTTTATACGGAAAATTTCCCCA
TTTACCTGAGACACCTGGGTTGGGTTTCTCATTTACATTTTTATTGCTACCGTTTTCCTT
AGCCTAGACAGGGTGAAGCTTATTCTGCGTACCACTTTGTGCGCTTAGGTTTTTTAATTT
TACCACCCAAGATACCCTTAACACCACCGCCATCCTGGTTGCCAGTAATCATTTTCTTAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004