login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: DM_CG3683
Organism Drosophila melanogaster
Gene Name CG3683
Product NADH-UBIQUINONE OXIDOREDUCTASE 19 KDA SUBUNIT (NUPM) (By similarity)
GENE MAP
Chromosome 2R
Citogenetic Map 60D13
Gene Map
Comment This record is derived from the following: AE003464 RH23043.complete AY071709 gb|AY071709|AY071709 RH23043 full length cDNA Reference sequence based on BDGP genomic sequence.
PRODUCT
Function Function: Transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Subcellular Location Mitochondrial inner membrane; matrix side
EC Number  --
Functional class Oxidative phosphorilation; Complex I: NADH ubiquinone oxidoredutase
EXTERNAL RESOURCES
GO GO:0008137
Molecular function: NADH dehydrogenase (ubiquinone) activity .
GO:0005739
Cellular component: mitochondrion.
SwissProt AC  --
FLYBASE FBgn0035046
View Sequence REFERENCE SEQUENCE
Scaffold AE003464
Sequence Location  --
Sequence Lenght 3060bp
Relative Gene location 1025 .. 2039
CDS
CDS Location 1151 .. 1968
Sequence Lenght 175aa
Translation MVITNNTTLPEESELNVQELNLSSAALRAGAFHLGKQCEQANNEFMLCRQELDDPRACLA
EGKAVTSCALDFFRKVKKTCHEEFTQYATCLDKSSGTMAFSHCRKTQGVFDKCIKDNFDW
DRPSYGYFSRAKVIQSAREAPKKEEKVSYPDATPGLPEDYPKPPAKYGSRFHWLE
mRNA
mRNA Location 1025 .. 2039
5'UTR Location 1025..1056,1108..1150
3'UTR Location 1969..2039
Exon 1025..1056,1108..1279,1454..1629,1693..1783, 1837..2039
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GATCTAAATCAGCTGTTGTGTTGTAAGCAAACCCTTTCAGGTTTTTGGTTGATCGCACAG
GACTGCAACGCTATT
ATGGTCATCACCAACAACACAACACTGCCCGAGGAGTCGGAGCTG
AACGTCCAGGAGCTAAATCTATCGTCGGCGGCCTTACGGGCAGGCGCCTTCCATTTGGGC
AAGCAATGCGAGCAGGCCAATAAT
GAGTTTATGCTGTGCCGGCAGGAGCTGGATGACCCG
CGAGCCTGTTTGGCGGAGGGCAAAGCCGTGACCAGCTGCGCCCTGGACTTCTTCCGCAAG
GTGAAGAAGACCTGCCATGAGGAGTTCACGCAGTACGCCACCTGCCTGGATAAGAGCAGC
GGTACTATGGCTTTTTCACA
TTGCCGCAAGACCCAGGGAGTGTTCGACAAGTGTATCAAA
GATAACTTCGACTGGGATCGTCCCTCCTATGGATACTTCTCGAGGGCCAAG
GTCATCCAA
TCAGCTCGGGAAGCACCCAAGAAGGAGGAGAAGGTCTCCTATCCCGATGCCACCCCCGGT
TTGCCCGAGGATTACCCCAAGCCGCCAGCAAAGTACGGTTCCCGCTTCCACTGGCTGGAG
TAG
ACAGCTGCCAGCGCCTAGTGAAATTTGAAAGCGTTCATCTTAATATAAACTCTTGTT
TCCATTAGTACTCG
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
AATGAAATGACTGAGATTAACCAGACAGCCATGAATATGAAATTTGCGGCTACTCAATCG
AGTCTGCTTCTGGCACCAGAAGCAGGCCAGCCTCCCCCAACTAATTGATTGCGATTTTGT
TAACCCATTTTGCTACTAAAAGAACATTTAATCATCAACAATGAATTTGAAAACTATGCG
CCCGCGGCCTTCGGAAGGATTTCTTGTGCAGGCTTGGAATCCCAGTCTCTATACCTAATT
TCTGGATTGCTCAGAATCTTGGCCACACCCTTCAGAAAGCTTGGCTTACTGATAGTGGTT
TTTCTCACAGAATCGTTGCTTTTCTTTTCCAAGGCATGCGGTATAAGTGAGGAAAAATTT
AGAGATGCCTCGTTAGTAAGTGTCCCATCTGAGGATTCAATTGGCAAGAGAGACATCCCC
TTATTTCGCTTGTTGTTGAACTTCTCGAGATATTTCTTGGCACCCAAACGGGCGGATGTC
TTTAAAGCATTCATATCCCAGGACACTCCCAGCTTGGATTTGATCTCCTCGGAGGCAGTC
TTGTCGTTCGAAGAGAACAGCGTTTGGAACATCTTCTTCAGCTCGAGGTCCTTGGGATCT
TGTAGCGATCGGACTGCCCGCGGATCAATCTGCCCAATGGAATTGTCTTGGCTTTTGGTT
TCCGCCTCCCGCTTGGAATCCTTGTTCAGCTCAACTAAGTCGTTTAACGACAATTTGGGG
TCCAAGTTCCCTTGCAGCTGCTGGAAATCCATTTCGGGCGCATCCTTCGGCAGGTAGCCG
CGGCTTTTCAGGTAAACTAGCGGCGACTGCCAGTTGTCGATGAGGTTCTTAACAATGGTG
TCAACCGAATTCTCATACTTAACTACTTTTAAATTGCGATCAGCTGCAGCACTATAAAAT
AGACAGATGTATAAGATTAAAGAAATCATTTTAATTTAAATTGTGAGCCTGTTATCGATG
ACTTTGTGAAACGGCTACACTATCGATATAAATTGTTATTGACAGCTACGTCTCAGCAGC
CCTGGATCTAAATCAGCTGTTGTGTTGTAAGCAAACGTAAAATTAACAAAATCCTACAAT
TATTTTGTTTTTTATTGAATTTCATAGCCTTTCAGGTTTTTGGTTGATCGCACAGGACTG
CAACGCTATT
ATGGTCATCACCAACAACACAACACTGCCCGAGGAGTCGGAGCTGAACGT
CCAGGAGCTAAATCTATCGTCGGCGGCCTTACGGGCAGGCGCCTTCCATTTGGGCAAGCA
ATGCGAGCAGGCCAATAAT
GTTAGTACATCCAGATTGCAGGGGAATCCTCCTGATAGTAA
TGCTTAGGTGAAAAGCGCCTTAAAGTGAAGCTGGGAGCCGCTGCCTCTTTAAAATCCGAG
CGGCTTAGTTATATAACCTAACCTCAAAAAGCACCTTCCCCGTTTGTTTACCTTTTCCTT
CGTGTAATTTCAGGAGTTTATGCTGTGCCGGCAGGAGCTGGATGACCCGCGAGCCTGTTT
GGCGGAGGGCAAAGCCGTGACCAGCTGCGCCCTGGACTTCTTCCGCAAGGTGAAGAAGAC
CTGCCATGAGGAGTTCACGCAGTACGCCACCTGCCTGGATAAGAGCAGCGGTACTATGGC
TTTTTCACA
GTAAGCACTCCGTAAATGTTGAATATTCCAATCATGCTATACCAATGTCCA
TCCATACTTTAGTTGCCGCAAGACCCAGGGAGTGTTCGACAAGTGTATCAAAGATAACTT
CGACTGGGATCGTCCCTCCTATGGATACTTCTCGAGGGCCAAG
GTAATTTCTCGGCATGC
TTTATTTAGACCTCTCCTAATCACTTCTGTTTTCAGGTCATCCAATCAGCTCGGGAAGCA
CCCAAGAAGGAGGAGAAGGTCTCCTATCCCGATGCCACCCCCGGTTTGCCCGAGGATTAC
CCCAAGCCGCCAGCAAAGTACGGTTCCCGCTTCCACTGGCTGGAGTAG
ACAGCTGCCAGC
GCCTAGTGAAATTTGAAAGCGTTCATCTTAATATAAACTCTTGTTTCCATTAGTACTCG
A
TATATTTATTTCATCGTATCTTTTTCCTCGACACAGTTTGCTTGATTTTGGCCATAATAT
CCAGGTACTGGTTGTTCAGGCAGCATCCGCAGTAGCTAACAGGGAAGCAGGCGCTGCCCT
CGATACGGCGGAAAAGTGGCGTGTTCTGATAGAAGACCCACGAGATGTTTTCTTCGCCCA
GCACCAGCATGATCTTGTCGAAGCGGACGCCCTGCACCTGAAACAGCTCCATGTCGCCGG
TGATGATGCGCCACTCTGCGTAGCGTATGTTAGCATCTGGGGGCAGCTTGGAGCGCTCCC
TCATCATCACATGCTCGAACCAATCGCGCACTTGGATAATCGATCCGGTGGGAGCGTGCT
TTCTGATCTGGTAGCTGATGCGCGGGTACAGAGGATTTCTGCGACAGGAATGAATGAGTT
TCTGGCGATCTCTTGGGTATTTATATTAATTGCTTACATGTAAGGAACAAAGGCCAGGCG
CACCAGCACAAATTCAACTTTCTCTCGAGGAGCCATCTTGAAGATAATTTTATTTTTATG
CGGACGACGCACTTCACAGGCACTGCTATGCAATACTAATGAACTTGGTCCACTGCTCAG
ACTATATATGCATAATACGCGACTTGCAGGCAGGTAGAATCATTGCTAAAGCAGATGTTC
CGTTTCTAATCCCAAGAAAAAGTCCCAGTTTTCCCGTTAGTTACCTGTATCGATTTTCTC
ATTTACAGTTTTATTGCTAAAAAGATTTTTCTTATCCTAGAAGAGGGAGCGCTACTCCGT
GTACCACTTGGTACGCTTAGGCTTCTTGATTTTACCTCCCGTAACGCCGCCACCTCCTTG
GTTTCCACTAATCATGTTCTTGTACTTATTAATTAGGGGCCGAAGGTCATCCGTTTCCTT
CTTGCGTCCTTGCTTGGGCCGATTATTTGCCTTGCGCTCTGCCAGGTGGGACTCGCGTAT
CTTCTTGTTCTTCTGCTTGCGCTTTTCGGTTTTCACCTTCTTCAAGTGTTCCTTGGCCTG
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004