login
   Home Search Cluster Blast Drome List Contact

Entry View

 
MitoDrome ID: AG-EG15210
Organism Anopheles gambiae str. PEST
Gene Name agEG15210
Product Ubiquinol-cytochrome C reductase complex 7.2 kDa protein (UCRX) (By similarity)
GENE MAP
Chromosome 2L
Celera Gene agCG55301
Citogenetic Map 20C
Gene Map
Comment This record is derived from the following: gb|AAAB01008968.1 gb|BM641271.1 5', mRNA sequence The following contributed to reference sequence development: bases 1..2405 - AAAB01008968.1 1546445..1548849
PRODUCT
Function This is a component of the ubiquinol-cytochrome C reductase complex (Complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain. This subunit interacts with cytochrome C1.
Subcellular Location Mitochondrial inner membrane
EC Number  --
Functional class Oxidative phosphorilation; Complex III: Ubiquinol-cytochrome C oxidoreductase complex
EXTERNAL RESOURCES
GO GO:0015008
Cellular component: ubiquinol-cytochrome-c reductase complex (sensu Eukarya).
GO:0008121
Molecular function: ubiquinol-cytochrome-c reductase activity.
GO:0006122
a
SwissProt AC  --
ENSEMBL (Anopheles) ENSANGG00000015210
View Sequence REFERENCE SEQUENCE
Scaffold AAAB01008968.1
Sequence Location 1546445..1548849
Sequence Lenght 2405bp
Relative Gene location 1001 .. 1400
CDS
CDS Location 1078 .. 1332
Sequence Lenght 56aa
Translation MKLLNNLLLKRTSTYLVGIAGAVFFFERGFDMITDTIFESHNKGKLWKDIKHKYEQ
mRNA
mRNA Location 1001 .. 1400
5'UTR Location 1001..1077
3'UTR Location 1333..1400
Exon 1001..1209,1294..1400
PolyA Signal  --
mRNA Sequence

 UTR region

 CDS region
GTTGACATTCGCACTTCTATCAGCTTGTGTTGTGATTGCAAGTGCAAAGAAAATTTCCAA
GGAATAGTCGAGCCAAA
ATGAAGCTGCTGAACAATTTGCTGTTGAAGCGCACCTCCACTT
ACCTGGTCGGAATTGCGGGAGCTGTATTTTTCTTCGAGCGCGGCTTCGATATGATAACAG
ATACCATTTTCGAATCCCACAACAAAGGG
AAATTATGGAAAGACATTAAGCACAAATACG
AGCAGTAA
AGATCGACTAACGTAATGAAGCCGAACAGCTTGCTGTTTATTGACTAATAAA
CCTTAGCTCACTAAAA
View Description REFERENCE SEQUENCE

 UTR region

 CDS region
ACCGAAGCATTTTGCCAAACAATTTGGAGCCGCTCCAGAAAATACGTTAATTTTCCATGT
TTTTTACTTAAATCGGAGGAGAAAAGTTTTGTAAAACGTAGATACACATGTCTTGCACGC
ATTGCATCCATTTTTGCAATGGAAAACGATGGAAAAACTACTAAATTTTGAGATCCGGCA
GGTCCATTCCCTCGATGACCAAAAAAAGCTTTCACCAGCCGCCGCCAGATGCGCTAGTGA
AAATCGAAATTACGCTTGCGAGTACGATCAATGTAGCCCGGCCTTTAGGAAAGTAAGAGT
GTTAAATTGCTTTAAACATTTTTTGTACTTATTCACATTAATACAAACATTTTCTGACCC
GTATTCACGCTGCCGAAAATAGGAACACAGCCTGCCGAAAATAGGAACAAACTGCCGAAA
ATAGGAGCAAAATCAATGTTTGCATTTTCACCAATATTTATGAAAAAGGGCTTTGAACCG
GCAAATAAAAAAAATATTGTAACATACTATGATAGTTTATCAACCAGAATAACTACACTT
TCAAGAAAAATAATGAAAAATATTGATGTGTGAGCAATTTTTGTGAAACTGCTGCACTAG
CCTGCCGAAAACTGGTACAGTTACCCTACTAAAATATGATGGTTTATGTTCGGTCGAAAA
ATAGCTTAAATTTGGAACAAAAAACACAAAGTTTACAATTTGATGGCCTATATCTCAGTA
AGTTTAAGATGAAAACGTGAAATATTTTGGTTTCAACTAAGTTTAAATATCTATTTAAAG
AAAATGATTATGGTGTTAACCTGTGATGAAGTTGGTTTTTCGATTTTTATGCAGGTGTTT
GCCCAATGTGCAATGGCGTATCTCGGGGACTACCTGTAGCTCGAAAATGGTTAATAGAAA
GTGACCTCGTTTCTTCATAGACTTTGGGCTCGGTGCGATGCAAATGACCTGCTAAATACA
TACACCTTTGACTTAAGAATCTTGCGTGTTTTTGGTCGAAGTTGACATTCGCACTTCTAT
CAGCTTGTGTTGTGATTGCAAGTGCAAAGAAAATTTCCAAGGAATAGTCGAGCCAAA
ATG
AAGCTGCTGAACAATTTGCTGTTGAAGCGCACCTCCACTTACCTGGTCGGAATTGCGGGA
GCTGTATTTTTCTTCGAGCGCGGCTTCGATATGATAACAGATACCATTTTCGAATCCCAC
AACAAAGGG
GTATGTATAAAAAGAGCAGTGCCGTGCGTAACGTTGCGACATGAGTTATGT
AATTTTGTGGTGACTCTTTTTCTTCCATTCCAGAAATTATGGAAAGACATTAAGCACAAA
TACGAGCAGTAA
AGATCGACTAACGTAATGAAGCCGAACAGCTTGCTGTTTATTGACTAA
TAAACCTTAGCTCACTAAAA
TTCTGAATACGTATTTCTTTTTGTATTTACTCCATCACTT
CCCACGGCTTTTCGGGTCGGTGCATATCCCAAGAATACGCCGGGCGAATTCTATTCGGTT
CCTTGAGACAAATACCACTCTCTTCGACAGTGCGTAGGAAAAGGTCCACCTTCTTTCCGG
TTGACGGTATAAAATCACATCGCACCTCGGTTAGTCCAGCATCCAAGCAACGCGAGGCGA
ATACTTTTCCCAGCGTAATGAACGCCGTGAAGTCATTTCCTTTGTACAGATGCCGCTTCA
GAGCCCATTCATTAGTGCTACATTCGATCACTGGTCCGTTTTCAAAGTGAACCAATTTAG
CTGTAACGTATTTTTTGCTAGCATTTAGCTCCAACCTACGTAATGAGATTTTTAGTTAAA
CCGGTTCATTGAAGCAATGTAAATTGTACAAACCTATGCCAGAAGTTTCGAACGGGTCTT
TCTAGATGATATCCGTCCACTTTGTATGCTAGTCTTAATCGTTCGAGATTTCTGGGGTTC
CTATTAACTACGTACAAGGTACCCTTAGAAACATTATTAGTTTGTTGAATTTTAGAAAAG
ATTTGTTTTGCACTACCCGCCATAGTTAAGGCCAATTTCTTGAATAGGGGGATTCATATA
AAGTAGGTGGTCATGAAGTGACAACATGAATAGCTTCGGCGGCGCTCTAGCAGCAATCGA
ACACGACATCCGACACGAACAAACCCATATAATCATATGGAGGTGCACTGTCAGACACAA
ACAAACAAACAAGACAAACGTCGAGTCGAACATTTCAGTTGATTCTGTCTGTGATGTTCG
ATACCCACCTGTGCTGTGAGTACCTTGGCTGTCAAACGCTTCACAGCTACAGTAGATAGA
ATTCATTTCGGGACATTTTTAAGTTTGTTTACGTAGTTTGTCTCTTTTTCTTCTTCAAAT
TGCGTGCAAAATATTTAAAATAGCTATCAATAATTATTGTTAAACTTTTCAATCAATTAA
AACAT
END
 
 

MitoDrome2 v1.05 - Last update: Jul 26th, 2006
Powered by Seagull Framework
visitors since Sep 27th, 2004